Property Summary

NCBI Gene PubMed Count 12
PubMed Score 10.39
PubTator Score 4.55

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (7)

AA Sequence

MWLPPALLLLSLSGCFSIQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQG      1 - 70
EKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMA     71 - 140
VFIGSHKRNHYMLLVFVKVPILLILVTAILWLKGSQRVPEEPGEQPIYMNFSEPLTKDMAT             141 - 201
//

Text Mined References (16)

PMID Year Title