Property Summary

NCBI Gene PubMed Count 25
PubMed Score 2.17
PubTator Score 2.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (12)

AA Sequence

MTPVRMQHSLAGQTYAVPFIQPDLRREEAVQQMADALQYLQKVSGDIFSRISQQVEQSRSQVQAIGEKVS      1 - 70
LAQAKIEKIKGSKKAIKVFSSAKYPAPGRLQEYGSIFTGAQDPGLQRRPRHRIQSKHRPLDERALQEKLK     71 - 140
DFPVCVSTKPEPEDDAEEGLGGLPSNISSVSSLLLFNTTENLYKKYVFLDPLAGAVTKTHVMLGAETEEK    141 - 210
LFDAPLSISKREQLEQQVPENYFYVPDLGQVPEIHVPSYLPDLPGIANDLMYSADLGPGIAPSAPGTIPE    211 - 280
LPTFHTEVAEPLKVDLQDGVLTPPPPPPPPPPAPEVLASAPPLPPSTAAPVGQGARQDDSSSSASPSVQG    281 - 350
APREVVDPSGGWATLLESIRQAGGIGKAKLRSMKERKLEKQQQKEQEQVRATSQGGHLMSDLFNKLVMRR    351 - 420
KGISGKGPGAGEGPGGAFVRVSDSIPPLPPPQQPQAEEDEDDWES                             421 - 465
//

Text Mined References (27)

PMID Year Title