Property Summary

NCBI Gene PubMed Count 22
PubMed Score 1.80
PubTator Score 2.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Synonym

Accession A8K0Z3
Symbols WASH
WASH1
FAM39E

Gene

Gene RIF (9)

PMID Text
26365382 The USP7 deubiquitinating enzyme is an integral component of the MAGE-L2-TRIM27 ligase and is essential for WASH-mediated endosomal actin assembly and protein recycling.
26066081 Stress-internalized EGFR co-segregates with exogenously expressed pre-melanosomal markers OA1 and fibrillar PMEL, following early endosomal sorting by the actin polymerization-promoting WASH complex
26041286 The WASH-VPEF/FAM21-retromer complexe mediates endosome fission and sorting of virus-containing vesicles prior to virus core uncoating in the cytoplasm.
25431135 FAM21 not only functions as an integral component of the cytoplasmic WASH complex, but also modulates NF-kappaB gene transcription in the nucleus.
24344185 WASH and the exocyst complex are required for matrix degradation by an exocytic mechanism that involves tubular connections between MT1-MMP-positive late endosomes and the plasma membrane in contact with the matrix.
22513087 Data show that a component of the WASH regulatory complex (SHRC), FAM21, directly interacts with the retromer CSC protein VPS35.
22114305 WASH and Arp2/3 regulates integrin alpha5beta1-mediated invasive cell migration.
20175130 Actin polymerization by WASH influences the shape and maturation of endosomes, and highlights a previously unrecognized role for WASH and the Arp2/3 complex in the degradative steps of endocytic trafficking.
19922874 WASH exists in a multiprotein complex containing FAM21, which links WASH to endosomes and is required for WASH-dependent retromer-mediated sorting.

AA Sequence

MTPVRMQHSLAGQTYAVPFIQPDLRREEAVQQMADALQYLQKVSGDIFSRISQQVEQSRSQVQAIGEKVS      1 - 70
LAQAKIEKIKGSKKAIKVFSSAKYPAPGRLQEYGSIFTGAQDPGLQRRPRHRIQSKHRPLDERALQEKLK     71 - 140
DFPVCVSTKPEPEDDAEEGLGGLPSNISSVSSLLLFNTTENLYKKYVFLDPLAGAVTKTHVMLGAETEEK    141 - 210
LFDAPLSISKREQLEQQVPENYFYVPDLGQVPEIHVPSYLPDLPGIANDLMYSADLGPGIAPSAPGTIPE    211 - 280
LPTFHTEVAEPLKVDLQDGVLTPPPPPPPPPPAPEVLASAPPLPPSTAAPVGQGARQDDSSSSASPSVQG    281 - 350
APREVVDPSGGWATLLESIRQAGGIGKAKLRSMKERKLEKQQQKEQEQVRATSQGGHLMSDLFNKLVMRR    351 - 420
KGISGKGPGAGEGPGGAFVRVSDSIPPLPPPQQPQAEEDEDDWES                             421 - 465
//

Text Mined References (24)

PMID Year Title
26365382 2015 USP7 Acts as a Molecular Rheostat to Promote WASH-Dependent Endosomal Protein Recycling and Is Mutated in a Human Neurodevelopmental Disorder.
26066081 2015 WASH and Tsg101/ALIX-dependent diversion of stress-internalized EGFR from the canonical endocytic pathway.
26041286 2015 Intracellular Transport of Vaccinia Virus in HeLa Cells Requires WASH-VPEF/FAM21-Retromer Complexes and Recycling Molecules Rab11 and Rab22.
25431135 2015 Nuclear FAM21 participates in NF-?B-dependent gene regulation in pancreatic cancer cells.
25355947 2015 COMMD1 is linked to the WASH complex and regulates endosomal trafficking of the copper transporter ATP7A.
24643499 2014 RME-8 coordinates the activity of the WASH complex with the function of the retromer SNX dimer to control endosomal tubulation.
24344185 2013 Endosomal WASH and exocyst complexes control exocytosis of MT1-MMP at invadopodia.
23974797 2013 WASH inhibits autophagy through suppression of Beclin 1 ubiquitination.
23452853 2013 Regulation of WASH-dependent actin polymerization and protein trafficking by ubiquitination.
22513087 2012 Multiple repeat elements within the FAM21 tail link the WASH actin regulatory complex to the retromer.
More...