Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Breast cancer 3578 9.4e-07

Expression

  Differential Expression (1)

Disease log2 FC p
Breast cancer -1.700 9.4e-07

 GO Function (1)

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MARRYDELPHYPSIADGPAALAGFPEAVPAAPGPYGPHRPPQPLPPGLDSDGLKRDKDEIYGHPLFPLLA      1 - 70
LVFEKCELATCSPRDGAGAGLGTPRGGDVCSSDSFNEDNTAFAKQVRSERPFFSSNPELDNLMIQAIQVL     71 - 140
RFHLLELEKGKMPIDLVIEDRDGGCREDFEDYPASCLSLPDQNNIWIRDHEDSGSVHLGTPGPSSGGLAS    141 - 210
QSGDNSSDQGVGLDTSVASPSSGGEDEDLDQEPRRNKKRGIFPKVATNIMRAWLFQHLWHPYPSEEQKKQ    211 - 280
LVQDTGLTILQVNNWFINARRRMVQPMIDQSNRIGQGAAFSPEGQPIGGYTETEPHVAFRPPASVGMSLN    281 - 350
LEGEWHYL                                                                  351 - 358
//

Text Mined References (2)

PMID Year Title