Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.0e-36
adrenocortical carcinoma 1428 2.6e-09
pituitary cancer 1972 6.2e-03

Expression

  Differential Expression (3)

Disease log2 FC p
adrenocortical carcinoma -4.500 2.6e-09
pituitary cancer -1.600 6.2e-03
psoriasis 3.000 2.0e-36

Synonym

Accession A8K010
Symbols C6orf176
bA142J11.1

 Compartment GO Term (1)

Gene RIF (3)

AA Sequence

MELSAAAGRRRQAPWREFTGRHRTERSQERGSTPRKERSMGSRQPRKREREPRDCTPTCTNAASVSRSGA      1 - 70
RRAPGCAGRCITMKNCARAWRELSERACCFQAVPPSNMKQSWLIFLDTTLCSAWLLASSCPRLYAPLISF     71 - 140
HCMCFNTVLLFPRLFGPTLSAKIQFNTDLSLRAIAWKCTKDTTTYC                            141 - 186
//

Text Mined References (8)

PMID Year Title