Property Summary

NCBI Gene PubMed Count 11
Grant Count 5
R01 Count 5
Funding $528,373.99
PubMed Score 10.75
PubTator Score 4.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -2.100 0.002
posterior fossa group B ependymoma -2.500 0.000
oligodendroglioma -1.400 0.016
glioblastoma -3.500 0.000
atypical teratoid / rhabdoid tumor -3.400 0.000
medulloblastoma, large-cell -1.100 0.004
primitive neuroectodermal tumor -1.900 0.032
pediatric high grade glioma -2.700 0.000
group 4 medulloblastoma 1.400 0.010
pilocytic astrocytoma -3.300 0.000
subependymal giant cell astrocytoma -3.806 0.002
lung carcinoma 2.400 0.000
Pick disease -1.100 0.005
ovarian cancer 1.300 0.000

Gene RIF (4)

PMID Text
26071481 The splicing of REST by SRRM4 could promote the neuroendocrine phenotype in CRPC.
25525873 Neural microexons are regulated by the neuronal-specific splicing factor nSR100/SRRM4, through its binding to adjacent intronic enhancer motifs; neural microexons are frequently misregulated in the brains of individuals with autism spectrum disorder, and this misregulation is associated with reduced levels of nSR100.
23928058 findings show that nSR100 plays a role in the alternative splicing of REST in small cell lung cancer (SCLC); study provides new insight into the role of nSR100 in the expression of sREST, possibly in the pathogenesis of SCLC
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MASVQQGEKQLFEKFWRGTFKAVATPRPESIIVASITARKPLPRTEPQNNPVVPAQDGPSEKLGQHLATE      1 - 70
PLGTNSWERDKTCRELGATRGHSASHDKDLTPPPSSRGKKKKKKSTRKKRRRSSSYSPSPVKKKKKKSSK     71 - 140
KHKRRRSFSKKRRHSSSSPKSKRRDEKRHKKQSRSRPRKSHRHRHHRCPSRSQSSESRPSSCESRHRGRS    141 - 210
PEEGQKSRRRHSRRCSKTLCKDSPEAQSSRPPSQPLQMLGYLSARGVITGSGSAADLFTKTASPLTTSRG    211 - 280
RSQEYDSGNDTSSPPSTQTSSARSRGQEKGSPSGGLSKSRELNSGNTSDSGNSFTTSSPQNKGAMLENLS    281 - 350
PTSRGRESRGFQSPCLECAEVKKSSLVPSTARSSPMKGCSRSSSYASTRSSSHSSRSPNPRASPRYTQSR    351 - 420
STSSEKRSYSRSPSYSSKSGKRSPPSRSSRSRRSPSYSRYSPSRERDPKYSEKDSQQRERERARRRRRSY    421 - 490
SPMRKRRRDSPSHLEARRITSARKRPIPYYRPSPSSSGSLSSTSSWYSSSSSRSASRSYSRSRSRSRSRR    491 - 560
RSRTRTSSSSSSRSPSPGSRSRSRSRSRSRSRSRSQSRSYSSADSYSSTRR                       561 - 611
//

Text Mined References (12)

PMID Year Title
26071481 2015 SRRM4 Expression and the Loss of REST Activity May Promote the Emergence of the Neuroendocrine Phenotype in Castration-Resistant Prostate Cancer.
25525873 2014 A highly conserved program of neuronal microexons is misregulated in autistic brains.
23928058 2013 The small cell lung cancer-specific isoform of RE1-silencing transcription factor (REST) is regulated by neural-specific Ser/Arg repeat-related protein of 100 kDa (nSR100).
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19737518 2009 Regulation of vertebrate nervous system alternative splicing and development by an SR-related protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12800201 2003 Novel tumor antigens identified by autologous antibody screening of childhood medulloblastoma cDNA libraries.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...