Property Summary

NCBI Gene PubMed Count 12
PubMed Score 11.45
PubTator Score 4.29

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.200 1.5e-05
astrocytic glioma -2.100 2.1e-03
Astrocytoma, Pilocytic -3.500 9.5e-11
atypical teratoid / rhabdoid tumor -3.400 3.1e-08
ependymoma -1.700 1.2e-02
glioblastoma -3.100 1.1e-10
group 4 medulloblastoma 1.400 1.0e-02
lung carcinoma 2.400 7.0e-29
medulloblastoma, large-cell -1.100 3.6e-03
oligodendroglioma -1.400 1.6e-02
ovarian cancer 1.100 3.1e-11
Pick disease -1.100 4.9e-03
primitive neuroectodermal tumor -1.900 3.2e-02
subependymal giant cell astrocytoma -3.301 1.9e-03

Gene RIF (5)

AA Sequence

MASVQQGEKQLFEKFWRGTFKAVATPRPESIIVASITARKPLPRTEPQNNPVVPAQDGPSEKLGQHLATE      1 - 70
PLGTNSWERDKTCRELGATRGHSASHDKDLTPPPSSRGKKKKKKSTRKKRRRSSSYSPSPVKKKKKKSSK     71 - 140
KHKRRRSFSKKRRHSSSSPKSKRRDEKRHKKQSRSRPRKSHRHRHHRCPSRSQSSESRPSSCESRHRGRS    141 - 210
PEEGQKSRRRHSRRCSKTLCKDSPEAQSSRPPSQPLQMLGYLSARGVITGSGSAADLFTKTASPLTTSRG    211 - 280
RSQEYDSGNDTSSPPSTQTSSARSRGQEKGSPSGGLSKSRELNSGNTSDSGNSFTTSSPQNKGAMLENLS    281 - 350
PTSRGRESRGFQSPCLECAEVKKSSLVPSTARSSPMKGCSRSSSYASTRSSSHSSRSPNPRASPRYTQSR    351 - 420
STSSEKRSYSRSPSYSSKSGKRSPPSRSSRSRRSPSYSRYSPSRERDPKYSEKDSQQRERERARRRRRSY    421 - 490
SPMRKRRRDSPSHLEARRITSARKRPIPYYRPSPSSSGSLSSTSSWYSSSSSRSASRSYSRSRSRSRSRR    491 - 560
RSRTRTSSSSSSRSPSPGSRSRSRSRSRSRSRSRSQSRSYSSADSYSSTRR                       561 - 611
//

Text Mined References (13)

PMID Year Title