Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.44
PubTator Score 3.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Gene RIF (4)

PMID Text
25494292 The two selected single nucleotide polymorphisms (SNPs) in TBKBP1 show no relationship with the clinical outcomes. None of the 12 SNPs is related to mSASSS.
23637848 TBKBP1 is associated with the severity of ankylosing spondylitis in the Chinese Han population
23286385 Studies show that three proteins expressed in HEK-293T cells (NAP1, TANK and TBKBP1) interact with TBK1.
17568778 results suggest that efficient signal transduction upon viral infection requires SINTBAD, TANK and NAP1 because they link TBK1 and IKKi to virus-activated signalling cascades

AA Sequence

MESMFEDDISILTQEALGPSEVWLDSPGDPSLGGDMCSASHFALITAYGDIKERLGGLERENATLRRRLK      1 - 70
VYEIKYPLISDFGEEHGFSLYEIKDGSLLEVEKVSLQQRLNQFQHELQKNKEQEEQLGEMIQAYEKLCVE     71 - 140
KSDLETELREMRALVETHLRQICGLEQQLRQQQGLQDAAFSNLSPPPAPAPPCTDLDLHYLALRGGSGLS    141 - 210
HAGWPGSTPSVSDLERRRLEEALEAAQGEARGAQLREEQLQAECERLQGELKQLQETRAQDLASNQSERD    211 - 280
MAWVKRVGDDQVNLALAYTELTEELGRLRELSSLQGRILRTLLQEQARSGGQRHSPLSQRHSPAPQCPSP    281 - 350
SPPARAAPPCPPCQSPVPQRRSPVPPCPSPQQRRSPASPSCPSPVPQRRSPVPPSCQSPSPQRRSPVPPS    351 - 420
CPAPQPRPPPPPPPGERTLAERAYAKPPSHHVKAGFQGRRSYSELAEGAAYAGASPPWLQAEAATLPKPR    421 - 490
AYGSELYGPGRPLSPRRAFEGIRLRFEKQPSEEDEWAVPTSPPSPEVGTIRCASFCAGFPIPESPAATAY    491 - 560
AHAEHAQSWPSINLLMETVGSDIRSCPLCQLGFPVGYPDDALIKHIDSHLENSKI                   561 - 615
//

Text Mined References (21)

PMID Year Title
25494292 2015 Analysis of clinical indexes and RUNX3, TBKBP1, PPARGC1B polymorphisms in Chinese Han patients with ankylosing spondylitis.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23637848 2013 Analysis of PPARGC1B, RUNX3 and TBKBP1 polymorphisms in Chinese Han patients with ankylosing spondylitis: a case-control study.
23286385 2013 Identification of proteins that interact with TANK binding kinase 1 and testing for mutations associated with glaucoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22190364 2011 Genome-wide meta-analysis identifies novel multiple sclerosis susceptibility loci.
21931631 2011 Functional dissection of the TBK1 molecular network.
21931555 2011 Vaccinia virus protein C6 is a virulence factor that binds TBK-1 adaptor proteins and inhibits activation of IRF3 and IRF7.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
More...