Property Summary

NCBI Gene PubMed Count 21
PubMed Score 85.73
PubTator Score 25.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma -3.100 6.6e-05
astrocytic glioma -2.000 2.9e-02
Astrocytoma, Pilocytic -1.700 1.9e-03
atypical teratoid / rhabdoid tumor -3.800 2.7e-08
ductal carcinoma in situ 1.100 8.2e-03
ependymoma -2.400 2.1e-02
glioblastoma -2.100 6.3e-05
group 3 medulloblastoma -1.700 2.2e-02
interstitial cystitis -1.300 1.6e-03
intraductal papillary-mucinous adenoma (... 1.500 4.4e-04
intraductal papillary-mucinous carcinoma... 1.400 6.4e-03
intraductal papillary-mucinous neoplasm ... 1.700 4.5e-03
invasive ductal carcinoma 2.000 2.2e-03
lung cancer 1.700 2.1e-02
medulloblastoma, large-cell -3.700 6.0e-05
oligodendroglioma -1.800 3.4e-02
osteosarcoma -2.131 5.0e-04
ovarian cancer -1.600 7.6e-08
pituitary cancer 1.300 2.2e-02
primitive neuroectodermal tumor -2.000 9.4e-03
spina bifida -1.792 3.6e-02
tuberculosis and treatment for 3 months 1.100 6.9e-05

Gene RIF (15)

AA Sequence

METESESSTLGDDSVFWLESEVIIQVTDCEEEEREEKFRKMKSSVHSEEDDFVPELHRNVHPRERPDWEE      1 - 70
TLSAMARGADVPEIPGDLTLKTCGSTASMKVKHVKKLPFTKGHFPKMAECAHFHYENVEFGSIQLSLSEE     71 - 140
QNEVMKNGCESKELVYLVQIACQGKSWIVKRSYEDFRVLDKHLHLCIYDRRFSQLSELPRSDTLKDSPES    141 - 210
VTQMLMAYLSRLSAIAGNKINCGPALTWMEIDNKGNHLLVHEESSINTPAVGAAHVIKRYTARAPDELTL    211 - 280
EVGDIVSVIDMPPKVLSTWWRGKHGFQVGLFPGHCVELINQKVPQSVTNSVPKPVSKKHGKLITFLRTFM    281 - 350
KSRPTKQKLKQRGILKERVFGCDLGEHLLNSGFEVPQVLQSCTAFIERYGIVDGIYRLSGVASNIQRLRH    351 - 420
EFDSEHVPDLTKEPYVQDIHSVGSLCKLYFRELPNPLLTYQLYEKFSDAVSAATDEERLIKIHDVIQQLP    421 - 490
PPHYRTLEFLMRHLSLLADYCSITNMHAKNLAIVWAPNLLRSKQIESACFSGTAAFMEVRIQSVVVEFIL    491 - 560
NHVDVLFSGRISMAMQEGAASLSRPKSLLVSSPSTKLLTLEEAQARTQAQVNSPIVTENKYIEVGEGPAA    561 - 630
LQGKFHTIIEFPLERKRPQNKMKKSPVGSWRSFFNLGKSSSVSKRKLQRNESEPSEMKAMALKGGRAEGT    631 - 700
LRSAKSEESLTSLHAVDGDSKLFRPRRPRSSSDALSASFNGEMLGNRCNSYDNLPHDNESEEEGGLLHIP    701 - 770
ALMSPHSAEDVDLSPPDIGVASLDFDPMSFQCSPPKAESECLESGASFLDSPGYSKDKPSANKKDAETGS    771 - 840
SQCQTPGSTASSEPVSPLQEKLSPFFTLDLSPTEDKSSKPSSFTEKVVYAFSPKIGRKLSKSPSMSISEP    841 - 910
ISVTLPPRVSEVIGTVSNTTAQNASSSTWDKCVEERDATNRSPTQIVKMKTNETVAQEAYESEVQPLDQV    911 - 980
AAEEVELPGKEDQSVSSSQSKAVASGQTQTGAVTHDPPQDSVPVSSVSLIPPPPPPKNVARMLALALAES    981 - 1050
AQQASTQSLKRPGTSQAGYTNYGDIAVATTEDNLSSSYSAVALDKAYFQTDRPAEQFHLQNNAPGNCDHP   1051 - 1120
LPETTATGDPTHSNTTESGEQHHQVDLTGNQPHQAYLSGDPEKARITSVPLDSEKSDDHVSFPEDQSGKN   1121 - 1190
SMPTVSFLDQDQSPPRFYSGDQPPSYLGASVDKLHHPLEFADKSPTPPNLPSDKIYPPSGSPEENTSTAT   1191 - 1260
MTYMTTTPATAQMSTKEASWDVAEQPTTADFAAATLQRTHRTNRPLPPPPSQRSAEQPPVVGQVQAATNI   1261 - 1330
GLNNSHKVQGVVPVPERPPEPRAMDDPASAFISDSGAAAAQCPMATAVQPGLPEKVRDGARVPLLHLRAE   1331 - 1400
SVPAHPCGFPAPLPPTRMMESKMIAAIHSSSADATSSSNYHSFVTASSTSVDDALPLPLPVPQPKHASQK   1401 - 1470
TVYSSFARPDVTTEPFGPDNCLHFNMTPNCQYRPQSVPPHHNKLEQHQVYGARSEPPASMGLRYNTYVAP   1471 - 1540
GRNASGHHSKPCSRVEYVSSLSSSVRNTCYPEDIPPYPTIRRVQSLHAPPSSMIRSVPISRTEVPPDDEP   1541 - 1610
AYCPRPLYQYKPYQSSQARSDYHVTQLQPYFENGRVHYRYSPYSSSSSSYYSPDGALCDVDAYGTVQLRP   1611 - 1680
LHRLPNRDFAFYNPRLQGKSLYSYAGLAPRPRANVTGYFSPNDHNVVSMPPAADVKHTYTSWDLEDMEKY   1681 - 1750
RMQSIRRESRARQKVKGPVMSQYDNMTPAVQDDLGGIYVIHLRSKSDPGKTGLLSVAEGKESRHAAKAIS   1751 - 1820
PEGEDRFYRRHPEAEMDRAHHHGGHGSTQPEKPSLPQKQSSLRSRKLPDMGCSLPEHRAHQEASHRQFCE   1821 - 1890
SKNGPPYPQGAGQLDYGSKGIPDTSEPVSYHNSGVKYAASGQESLRLNHKEVRLSKEMERPWVRQPSAPE   1891 - 1960
KHSRDCYKEEEHLTQSIVPPPKPERSHSLKLHHTQNVERDPSVLYQYQPHGKRQSSVTVVSQYDNLEDYH   1961 - 2030
SLPQHQRGVFGGGGMGTYVPPGFPHPQSRTYATALGQGAFLPAELSLQHPETQIHAE                2031 - 2087
//

Text Mined References (27)

PMID Year Title