Property Summary

NCBI Gene PubMed Count 21
PubMed Score 80.31
PubTator Score 25.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 5.86081978109365E-8
ovarian cancer 8492 7.63968296397251E-8
glioblastoma 5572 2.81984739103362E-5
interstitial cystitis 2299 4.53074799627448E-5
medulloblastoma 1524 4.83350199558711E-5
medulloblastoma, large-cell 6234 6.01676049926695E-5
adult high grade glioma 2148 6.58965320721207E-5
tuberculosis and treatment for 3 months 327 6.90800732582105E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 4.36354890352288E-4
osteosarcoma 7933 5.04582533915465E-4
pilocytic astrocytoma 3086 0.00172599521573783
invasive ductal carcinoma 2950 0.00219513185556811
primitive neuroectodermal tumor 3031 0.0033828526550184
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0045165635369606
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00641808397788376
ductal carcinoma in situ 1745 0.00817472774408192
lung cancer 4473 0.0209848549361523
ependymoma 2514 0.0209849034963582
pituitary cancer 1972 0.0221774509664037
astrocytic glioma 2241 0.0293927296157885
oligodendroglioma 2849 0.0338701360832927
spina bifida 1064 0.0358850273591566
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Schizotypal personality disorder 8 3.41 1.7

Expression

Synonym

Accession A7KAX9 I7H0B0 O94820 Q86YL6 Q8IUG4 Q9BWG3
Symbols GRIT
RICS
GC-GAP
PX-RICS
p250GAP
p200RhoGAP

Gene

PDB

3IUG  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA Inparanoid
Pig OMA EggNOG
Platypus OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid

Gene RIF (15)

PMID Text
23226367 Cdh1-APC together with the RhoA regulators p250GAP and Smurf1 controls axon growth in the mammalian brain
22530067 the p250GAP gene might be a new candidate gene for susceptibility to schizophrenia.
20308060 The PX-RICS-14-3-3zeta/theta complex couples N-cadherin-beta-catenin with dynein-dynactin to mediate its export from the endoplasmic reticulum.
18577589 miR132-p250GAP pathway plays a key role in activity-dependent structural and functional plasticity.
18451111 Results suggest that PX-RICS ensures the efficient entry of the N-cadherin/beta-catenin complex into the secretory pathway, and thereby regulates the amount of N-cadherin available for cell adhesion and FGFR4-mediated signaling.
18187620 Knockdown of Rho GTPase activating protein 32 (ARHGAP32; RICS) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17663722 Results suggest that a splice variant of RICS, PX-RICS, is involved in early brain development including extension of axons and dendrites, and postnatal remodeling and fine-tuning of neural circuits.
12857875 p250GAP is likely to be involved in actin reorganization in dendritic spines
12857875 p250GAP may be involved in NMDA receptor activity-dependent actin reorganization in dendritic spines
12819203 GC-GAP may play a role in dendritic morphogenesis and also possibly in neural/glial cell proliferation
More...

AA Sequence

METESESSTLGDDSVFWLESEVIIQVTDCEEEEREEKFRKMKSSVHSEEDDFVPELHRNVHPRERPDWEE      1 - 70
TLSAMARGADVPEIPGDLTLKTCGSTASMKVKHVKKLPFTKGHFPKMAECAHFHYENVEFGSIQLSLSEE     71 - 140
QNEVMKNGCESKELVYLVQIACQGKSWIVKRSYEDFRVLDKHLHLCIYDRRFSQLSELPRSDTLKDSPES    141 - 210
VTQMLMAYLSRLSAIAGNKINCGPALTWMEIDNKGNHLLVHEESSINTPAVGAAHVIKRYTARAPDELTL    211 - 280
EVGDIVSVIDMPPKVLSTWWRGKHGFQVGLFPGHCVELINQKVPQSVTNSVPKPVSKKHGKLITFLRTFM    281 - 350
KSRPTKQKLKQRGILKERVFGCDLGEHLLNSGFEVPQVLQSCTAFIERYGIVDGIYRLSGVASNIQRLRH    351 - 420
EFDSEHVPDLTKEPYVQDIHSVGSLCKLYFRELPNPLLTYQLYEKFSDAVSAATDEERLIKIHDVIQQLP    421 - 490
PPHYRTLEFLMRHLSLLADYCSITNMHAKNLAIVWAPNLLRSKQIESACFSGTAAFMEVRIQSVVVEFIL    491 - 560
NHVDVLFSGRISMAMQEGAASLSRPKSLLVSSPSTKLLTLEEAQARTQAQVNSPIVTENKYIEVGEGPAA    561 - 630
LQGKFHTIIEFPLERKRPQNKMKKSPVGSWRSFFNLGKSSSVSKRKLQRNESEPSEMKAMALKGGRAEGT    631 - 700
LRSAKSEESLTSLHAVDGDSKLFRPRRPRSSSDALSASFNGEMLGNRCNSYDNLPHDNESEEEGGLLHIP    701 - 770
ALMSPHSAEDVDLSPPDIGVASLDFDPMSFQCSPPKAESECLESGASFLDSPGYSKDKPSANKKDAETGS    771 - 840
SQCQTPGSTASSEPVSPLQEKLSPFFTLDLSPTEDKSSKPSSFTEKVVYAFSPKIGRKLSKSPSMSISEP    841 - 910
ISVTLPPRVSEVIGTVSNTTAQNASSSTWDKCVEERDATNRSPTQIVKMKTNETVAQEAYESEVQPLDQV    911 - 980
AAEEVELPGKEDQSVSSSQSKAVASGQTQTGAVTHDPPQDSVPVSSVSLIPPPPPPKNVARMLALALAES    981 - 1050
AQQASTQSLKRPGTSQAGYTNYGDIAVATTEDNLSSSYSAVALDKAYFQTDRPAEQFHLQNNAPGNCDHP   1051 - 1120
LPETTATGDPTHSNTTESGEQHHQVDLTGNQPHQAYLSGDPEKARITSVPLDSEKSDDHVSFPEDQSGKN   1121 - 1190
SMPTVSFLDQDQSPPRFYSGDQPPSYLGASVDKLHHPLEFADKSPTPPNLPSDKIYPPSGSPEENTSTAT   1191 - 1260
MTYMTTTPATAQMSTKEASWDVAEQPTTADFAAATLQRTHRTNRPLPPPPSQRSAEQPPVVGQVQAATNI   1261 - 1330
GLNNSHKVQGVVPVPERPPEPRAMDDPASAFISDSGAAAAQCPMATAVQPGLPEKVRDGARVPLLHLRAE   1331 - 1400
SVPAHPCGFPAPLPPTRMMESKMIAAIHSSSADATSSSNYHSFVTASSTSVDDALPLPLPVPQPKHASQK   1401 - 1470
TVYSSFARPDVTTEPFGPDNCLHFNMTPNCQYRPQSVPPHHNKLEQHQVYGARSEPPASMGLRYNTYVAP   1471 - 1540
GRNASGHHSKPCSRVEYVSSLSSSVRNTCYPEDIPPYPTIRRVQSLHAPPSSMIRSVPISRTEVPPDDEP   1541 - 1610
AYCPRPLYQYKPYQSSQARSDYHVTQLQPYFENGRVHYRYSPYSSSSSSYYSPDGALCDVDAYGTVQLRP   1611 - 1680
LHRLPNRDFAFYNPRLQGKSLYSYAGLAPRPRANVTGYFSPNDHNVVSMPPAADVKHTYTSWDLEDMEKY   1681 - 1750
RMQSIRRESRARQKVKGPVMSQYDNMTPAVQDDLGGIYVIHLRSKSDPGKTGLLSVAEGKESRHAAKAIS   1751 - 1820
PEGEDRFYRRHPEAEMDRAHHHGGHGSTQPEKPSLPQKQSSLRSRKLPDMGCSLPEHRAHQEASHRQFCE   1821 - 1890
SKNGPPYPQGAGQLDYGSKGIPDTSEPVSYHNSGVKYAASGQESLRLNHKEVRLSKEMERPWVRQPSAPE   1891 - 1960
KHSRDCYKEEEHLTQSIVPPPKPERSHSLKLHHTQNVERDPSVLYQYQPHGKRQSSVTVVSQYDNLEDYH   1961 - 2030
SLPQHQRGVFGGGGMGTYVPPGFPHPQSRTYATALGQGAFLPAELSLQHPETQIHAE                2031 - 2087
//

Text Mined References (27)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
23226367 2012 p250GAP is a novel player in the Cdh1-APC/Smurf1 pathway of axon growth regulation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22530067 2012 The p250GAP gene is associated with risk for schizophrenia and schizotypal personality traits.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20308060 2010 The PX-RICS-14-3-3zeta/theta complex couples N-cadherin-beta-catenin with dynein-dynactin to mediate its export from the endoplasmic reticulum.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...