Property Summary

NCBI Gene PubMed Count 20
Grant Count 6
R01 Count 6
Funding $669,740
PubMed Score 10.99
PubTator Score 5.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
ependymoma -1.300 0.000
glioblastoma -1.700 0.000
medulloblastoma -1.500 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
medulloblastoma, large-cell -1.500 0.002
primitive neuroectodermal tumor -1.600 0.000
acute quadriplegic myopathy -1.757 0.000
lung cancer 3.700 0.000
adult high grade glioma -1.900 0.000
pilocytic astrocytoma -1.500 0.000
ovarian cancer -1.200 0.000

Gene RIF (8)

PMID Text
23800289 Digenic mutational inheritance of the integrin alpha 7 and the myosin heavy chain 7B genes causes congenital myopathy with left ventricular non-compact cardiomyopathy. [MYH7B]
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20520619 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20224305 Observational study of gene-disease association. (HuGE Navigator)
20154144 Data suggest that transcription and alternative splicing uncouple the level of expression of MYH7b and miR-499 when their coexpression is not required.
19948655 MYH7b, the ortholog of slow myosin 2 (SM2) of frogs and birds, is detected as mRNA in heart, slow muscles and extraocular muscles. MYH7b protein is detected only in a subset of fibers, corresponding to slow-tonic fibers, in extraocular muscles.
19913121 Observational study of gene-disease association. (HuGE Navigator)
18634034 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MMDVSELGESARYLRQGYQEMTKVHTIPWDGKKRVWVPDEQDAYVEAEVKSEATGGRVTVETKDQKVLMV      1 - 70
REAELQPMNPPRFDLLEDMAMMTHLNEASVLHNLRQRYARWMIYTYSGLFCVTINPYKWLPVYTASVVAA     71 - 140
YKGKRRSDSPPHIYAVADNAYNDMLRNRDNQSMLITGESGAGKTVNTKRVIQYFAIVAALGDGPGKKAQF    141 - 210
LATKTGGTLEDQIIEANPAMEAFGNAKTLRNDNSSRFGKFIRIHFGPSGKLASADIDSYLLEKSRVIFQL    211 - 280
PGERSYHVYYQILSGRKPELQDMLLLSMNPYDYHFCSQGVITVDNMNDGEELIATDHAMDILGFSVDEKC    281 - 350
ACYKIVGALLHFGNMKFKQKQREEQAEADGTESADKAAYLMGVSSGDLLKGLLHPRVRVGNEYVTKGQSV    351 - 420
EQVVFAVGALAKATYDRLFRWLVSRINQTLDTKLPRQFFIGVLDIAGFEIFEFNSFEQLCINFTNEKLQQ    421 - 490
FFNQHMFVLEQEEYKREGIDWVFIDFGLDLQPCIDLIEKPLGILSILEEECMFPKASDASFRAKLYDNHA    491 - 560
GKSPNFQQPRPDKKRKYQAHFEVVHYAGVVPYSIVGWLEKNKDPLNETVVPIFQKSQNRLLATLYENYAG    561 - 630
SCSTEPPKSGVKEKRKKAASFQTVSQLHKENLNKLMTNLRATQPHFVRCIVPNENKTPGVMDAFLVLHQL    631 - 700
RCNGVLEGIRICRQGFPNRLLYTDFRQRYRILNPSAIPDDTFMDSRKATEKLLGSLDLDHTQYQFGHTKV    701 - 770
FFKAGLLGVLEELRDQRLAKVLTLLQARSRGRLMRLEYQRLLGGRDALFTIQWNIRAFNAVKNWSWMKLF    771 - 840
FKMKPLLRSAQAEEELAALRAELRGLRGALAAAEAKRQELEETHVSITQEKNDLALQLQAEQDNLADAEE    841 - 910
RCHLLIKSKVQLEGKVKELSERLEDEEEVNADLAARRRKLEDECTELKKDIDDLKLTLAKAEKEKQATEN    911 - 980
KVKNLTEEMAALDESVARLTKEKKALQEAHQQALGDLQAEEDRVSALTKAKLRLEQQVEDLECSLEQEKK    981 - 1050
LRMDTERAKRKLEGDLKLTQESVADAAQDKQQLEEKLKKKDSELSQLSLRVEDEQLLGAQMQKKIKELQA   1051 - 1120
RAEELEEELEAERAARARVEKQRAEAARELEELSERLEEAGGASAGQREGCRKREAELGRLRRELEEAAL   1121 - 1190
RHEATVAALRRKQAEGAAELGEQVDSLQRVRQKLEKEKSELRMEVDDLAANVETLTRAKASAEKLCRTYE   1191 - 1260
DQLSEAKIKVEELQRQLADASTQRGRLQTESGELSRLLEEKECLISQLSRGKALAAQSLEELRRQLEEES   1261 - 1330
KAKSALAHAVQALRHDCDLLREQHEEEAEAQAELQRLLSKANAEVAQWRSKYEADAIQRTEELEEAKKKL   1331 - 1400
ALRLQEAEEGVEAANAKCSSLEKAKLRLQTESEDVTLELERATSAAAALDKKQRHLERALEERRRQEEEM   1401 - 1470
QRELEAAQRESRGLGTELFRLRHGHEEALEALETLKRENKNLQEEISDLTDQVSLSGKSIQELEKTKKAL   1471 - 1540
EGEKSEIQAALEEAEGALELEETKTLRIQLELSQVKAEVDRKLAEKDEECANLRRNHQRAVESLQASLDA   1541 - 1610
ETRARNEALRLKKKMEGDLNDLELQLGHATRQATEAQAATRLMQAQLKEEQAGRDEEQRLAAELHEQAQA   1611 - 1680
LERRASLLAAELEELRAALEQGERSRRLAEQELLEATERLNLLHSQNTGLLNQKKKLEADLAQLSGEVEE   1681 - 1750
AAQERREAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKTLEQTVRELQARLEEAEQAALRGGKKQVQ   1751 - 1820
KLEAKVRELEAELDAEQKKHAEALKGVRKHERRVKELAYQAEEDRKNLARMQDLVDKLQSKVKSYKRQFE   1821 - 1890
EAEQQANTNLAKYRKAQHELDDAEERADMAETQANKLRARTRDALGPKHKE                      1891 - 1941
//

Text Mined References (21)

PMID Year Title
23800289 2013 Digenic mutational inheritance of the integrin alpha 7 and the myosin heavy chain 7B genes causes congenital myopathy with left ventricular non-compact cardiomyopathy.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
22703881 2012 Genetic associations for activated partial thromboplastin time and prothrombin time, their gene expression profiles, and risk of coronary artery disease.
22443383 2012 Genome wide association study for plasma levels of natural anticoagulant inhibitors and protein C anticoagulant pathway: the MARTHA project.
22216198 2011 A genome-wide association study of the Protein C anticoagulant pathway.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20520619 2010 Common genetic variants in pre-microRNAs and risk of gallbladder cancer in North Indian population.
20224305 2010 Modest association of malignant melanoma with the rs910873 and rs1885120 markers on chromosome 20: a population-based study.
20154144 2010 Uncoupling of expression of an intronic microRNA and its myosin host gene by exon skipping.
19948655 2010 Two novel/ancient myosins in mammalian skeletal muscles: MYH14/7b and MYH15 are expressed in extraocular muscles and muscle spindles.
More...