Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.11
PubTator Score 0.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 2.35656881433509E-21
Breast cancer 3099 7.12923013048509E-6
pituitary cancer 1972 1.45371646474113E-4
nasopharyngeal carcinoma 1056 4.81418968493515E-4
atypical teratoid/rhabdoid tumor 1095 9.51778718392268E-4
glioblastoma 5572 0.00311337885995486
chronic rhinosinusitis 512 0.0269021611346893

Expression

  Differential Expression (7)

Disease log2 FC p
posterior fossa group B ependymoma 4.700 0.000
glioblastoma 1.100 0.003
atypical teratoid/rhabdoid tumor 1.100 0.001
nasopharyngeal carcinoma -1.600 0.000
Breast cancer -1.100 0.000
pituitary cancer -1.100 0.000
chronic rhinosinusitis -1.758 0.027

Synonym

Accession A7E2U8 Q5BLP7
Symbols

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MPAEGGKTDMERIGLFSEMEYITVGDKYVSQFNRPFNEAASKNKQMLPGGSKEMSDLQAGYFDPHFVRIF      1 - 70
EGEGYINLNQVRRRDMVEAAKKNLGKAFLPSNGEKKPCGLGSYYGTIGGPVPFFSAQSKPREKYKAPGKN     71 - 140
LYTNPGKKGTGYGYANITIGKQFSHSADFYDAAKLKYKKANEEHHRLLKGAPFKLNLHPRDYFDANPYFS    141 - 210
EESLPPIKKEEKKKTISNTFKPSSPGKKPGGMKAGTFDPYPSHSADPYVAKLANISGKDDKIFHPPSGPK    211 - 280
SRPVESIMTLNVRRALNSKNYKTSSVPSY                                             281 - 309
//

Text Mined References (7)

PMID Year Title
25074808 2014 Proteomic analysis of mammalian sperm cells identifies new components of the centrosome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15809229 2005 Comparative gene finding in chicken indicates that we are closing in on the set of multi-exonic widely expressed human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.