Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.11
PubTator Score 0.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.100 9.5e-04
Breast cancer -1.100 7.1e-06
chronic rhinosinusitis -1.758 2.7e-02
ependymoma 4.100 2.1e-02
glioblastoma 1.100 3.1e-03
nasopharyngeal carcinoma -1.600 4.8e-04
pituitary cancer -1.100 1.5e-04

Synonym

Accession A7E2U8 Q5BLP7
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MPAEGGKTDMERIGLFSEMEYITVGDKYVSQFNRPFNEAASKNKQMLPGGSKEMSDLQAGYFDPHFVRIF      1 - 70
EGEGYINLNQVRRRDMVEAAKKNLGKAFLPSNGEKKPCGLGSYYGTIGGPVPFFSAQSKPREKYKAPGKN     71 - 140
LYTNPGKKGTGYGYANITIGKQFSHSADFYDAAKLKYKKANEEHHRLLKGAPFKLNLHPRDYFDANPYFS    141 - 210
EESLPPIKKEEKKKTISNTFKPSSPGKKPGGMKAGTFDPYPSHSADPYVAKLANISGKDDKIFHPPSGPK    211 - 280
SRPVESIMTLNVRRALNSKNYKTSSVPSY                                             281 - 309
//

Text Mined References (7)

PMID Year Title