Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A7E2S9 B8ZZL7
Symbols ANKRD30BP3
NCRNA00164

Gene

 Compartment GO Term (0)

AA Sequence

MERLSAAPVKGQTGPERPSPFSQLVYTNNDSYVIHHGDLRKIHKAASRGQAWKLERMMKKTTMDLNIRDA      1 - 70
KKRTALYWACANGHAEVVTLLVDRKCQLDVLDGENRTILMKALQCQREACANILIDSGADPNIVDVYGNT     71 - 140
AVHYAVNSENLSVVAKLLSCGADIEVKNKAGHTPLLLAIRKRSEEIVEFLLTKNANANAVDKFKCVHQQL    141 - 210
LEYKQKISKNSQNSNPEGTSEGTPDEAAPLAERTPDTAESLVERTPDE                          211 - 258
//

Text Mined References (5)

PMID Year Title
17114284 2006 Characterization of a cancer/testis (CT) antigen gene family capable of eliciting humoral response in cancer patients.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15197164 2004 A transcript finishing initiative for closing gaps in the human transcriptome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.