Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.62
PubTator Score 4.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
breast carcinoma 1614 1.31421264231236E-21
Breast cancer 3099 1.23414017749228E-8
Pick disease 1893 2.77942092993698E-7
ovarian cancer 8492 1.29180598311291E-5
Amyotrophic Lateral Sclerosis 432 6.33439496906135E-5
acute quadriplegic myopathy 1157 4.67468623077974E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 5.54588282518327E-4
glioblastoma 5572 0.00120730863588473
ulcerative colitis 2087 0.00179110613326179
ependymoma 2514 0.00334336123937294
dermatomyositis 967 0.00396148576876849
colon cancer 1475 0.00507855811464477
progressive supranuclear palsy 674 0.00525234253831453
astrocytic glioma 2241 0.00531360316764988
pediatric high grade glioma 2712 0.00575388372024497
oligodendroglioma 2849 0.0217374632918555
hereditary spastic paraplegia 313 0.0256452872654358
Disease Target Count Z-score Confidence
Cerebral amyloid angiopathy 9 3.459 1.7

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma 2.300 0.005
ependymoma 2.400 0.003
oligodendroglioma 2.100 0.022
glioblastoma -1.600 0.001
hereditary spastic paraplegia -1.077 0.026
Amyotrophic Lateral Sclerosis 1.231 0.000
acute quadriplegic myopathy 1.403 0.000
pancreatic ductal adenocarcinoma liver m... 2.371 0.001
colon cancer -1.900 0.005
breast carcinoma -1.600 0.000
pediatric high grade glioma -1.200 0.006
Pick disease -3.500 0.000
progressive supranuclear palsy -2.800 0.005
Breast cancer -1.700 0.000
ulcerative colitis 1.400 0.002
ovarian cancer -2.000 0.000
dermatomyositis 1.500 0.004

Synonym

Gene

PANTHER Protein Class (1)

AA Sequence

MLPVDGEERKSEGSDTEGDRTSPCAVSSATLKDLEVGGSGRRCSDPAGQPSNLLPQRGLGAPLPAETAHT      1 - 70
QPSPNDRSLYLSPKSSSASSSLHARQSPCQEQAAVLNSRSIKISRLNDTIKSLKQQKKQVEHQLEEEKKA     71 - 140
NNEKQKAERELEGQIQRLNTEKKKLNTDLYHMKHSLRYFEEESKDLAGRLQRSSQRIGELEWSLCAVAAT    141 - 210
QKKKPDGFSSRSKALLKRQLEQSIREQILLKGHVTQLKESLKEVQLERDQYAEQIKGERAQWQQRMRKMS    211 - 280
QEVCTLKEEKKHDTHRVEELERSLSRLKNQMAEPLPPDAPAVSSEVELQDLRKELERVAGELQAQVENNQ    281 - 350
CISLLNRGQKERLREQEERLQEQQERLREREKRLQQLAEPQSDLEELKHENKSALQLEQQVKELQEKLGQ    351 - 420
VMETLTSAEKEPEAAVPASGTGGESSGLMDLLEEKADLREHVEKLELGFIQYRRERCHQKVHRLLTEPGD    421 - 490
SAKDASPGGGHHQAGPGQGGEEGEAAGAAGDGVAACGSYSEGHGKFLAAARNPAAEPSPGAPAPQELGAA    491 - 560
DKHGDLCEASLTNSVEPAQGEAREGSSQDNPTAQPVVQLLGEMQDHQEHPGLGSNCCVPCFCWAWLPRRR    561 - 630
R//

Text Mined References (8)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10677249 2000 Human autoantibodies to a novel Golgi protein golgin-67: high similarity with golgin-95/gm 130 autoantigen.
10660574 2000 Identification and characterization of a novel Golgi protein, golgin-67.
10048485 1998 Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.