Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.62
PubTator Score 4.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
acute quadriplegic myopathy 1.403 4.7e-04
Amyotrophic lateral sclerosis 1.231 6.3e-05
astrocytic glioma 2.300 5.3e-03
Breast cancer -1.700 1.2e-08
breast carcinoma -1.100 7.0e-05
colon cancer -1.900 5.1e-03
dermatomyositis 1.500 4.0e-03
ependymoma 2.400 3.3e-03
glioblastoma -1.600 1.2e-03
hereditary spastic paraplegia -1.077 2.6e-02
oligodendroglioma 2.100 2.2e-02
ovarian cancer -2.000 1.3e-05
pancreatic ductal adenocarcinoma liver m... 2.371 5.5e-04
pediatric high grade glioma -1.200 5.8e-03
Pick disease -3.500 2.8e-07
progressive supranuclear palsy -2.800 5.3e-03
ulcerative colitis 1.400 1.8e-03

Gene RIF (1)

AA Sequence

MLPVDGEERKSEGSDTEGDRTSPCAVSSATLKDLEVGGSGRRCSDPAGQPSNLLPQRGLGAPLPAETAHT      1 - 70
QPSPNDRSLYLSPKSSSASSSLHARQSPCQEQAAVLNSRSIKISRLNDTIKSLKQQKKQVEHQLEEEKKA     71 - 140
NNEKQKAERELEGQIQRLNTEKKKLNTDLYHMKHSLRYFEEESKDLAGRLQRSSQRIGELEWSLCAVAAT    141 - 210
QKKKPDGFSSRSKALLKRQLEQSIREQILLKGHVTQLKESLKEVQLERDQYAEQIKGERAQWQQRMRKMS    211 - 280
QEVCTLKEEKKHDTHRVEELERSLSRLKNQMAEPLPPDAPAVSSEVELQDLRKELERVAGELQAQVENNQ    281 - 350
CISLLNRGQKERLREQEERLQEQQERLREREKRLQQLAEPQSDLEELKHENKSALQLEQQVKELQEKLGQ    351 - 420
VMETLTSAEKEPEAAVPASGTGGESSGLMDLLEEKADLREHVEKLELGFIQYRRERCHQKVHRLLTEPGD    421 - 490
SAKDASPGGGHHQAGPGQGGEEGEAAGAAGDGVAACGSYSEGHGKFLAAARNPAAEPSPGAPAPQELGAA    491 - 560
DKHGDLCEASLTNSVEPAQGEAREGSSQDNPTAQPVVQLLGEMQDHQEHPGLGSNCCVPCFCWAWLPRRR    561 - 630
R//

Text Mined References (9)

PMID Year Title