Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.47
PubTator Score 3.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Von Hippel-Lindau disease 11 3.101 1.6

Expression

Synonym

Accession A6ZKI3
Symbols CXX1
Mar8
MAR8C
Mart8
MART8C

Gene

 Compartment GO Term (0)

AA Sequence

MDGRVQLIKALLALPIRPATRRWRNPIPFPETFDGDTDRLPEFIVQTGSYMFVDENTFSSDALKVTFLIT      1 - 70
RLTGPALQWVIPYIKKESPLLNDYRGFLAEMKRVFGWEEDEDF                                71 - 113
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21269460 2011 Initial characterization of the human central proteome.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16093683 2005 A family of neofunctionalized Ty3/gypsy retrotransposon genes in mammalian genomes.
15772651 2005 The DNA sequence of the human X chromosome.
15716091 2005 Transposable elements as a source of genetic innovation: expression and evolution of a family of retrotransposon-derived neogenes in mammals.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9403077 1997 A low-copy repeat in Xq26 represents a novel putatively prenylated protein gene (CXX1) and its pseudogenes (DXS9914, DXS9915, and DXS9916).
9110174 1997 Large-scale concatenation cDNA sequencing.
More...