Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.46
PubTator Score 3.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
acute myeloid leukemia -1.400 1.1e-02
esophageal adenocarcinoma -1.100 1.9e-02
group 3 medulloblastoma -1.100 2.6e-04
malignant mesothelioma -1.600 8.7e-07
medulloblastoma, large-cell -1.200 1.5e-03
ovarian cancer -1.500 3.8e-06
Pick disease -1.100 1.5e-05
primary pancreatic ductal adenocarcinoma 1.011 3.3e-03

AA Sequence

MDGRVQLIKALLALPIRPATRRWRNPIPFPETFDGDTDRLPEFIVQTGSYMFVDENTFSSDALKVTFLIT      1 - 70
RLTGPALQWVIPYIKKESPLLNDYRGFLAEMKRVFGWEEDEDF                                71 - 113
//

Text Mined References (11)

PMID Year Title