Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.57
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -1.300 1.1e-02
Astrocytoma, Pilocytic -1.800 4.6e-04
Breast cancer -1.900 6.1e-12
cystic fibrosis 1.200 3.4e-04
glioblastoma -1.600 2.2e-03
group 4 medulloblastoma -1.300 1.9e-03
interstitial cystitis -1.500 3.5e-03
lung carcinoma 1.600 1.2e-14
medulloblastoma, large-cell -1.900 3.4e-05
non-small cell lung cancer 1.920 4.1e-11
osteosarcoma -1.354 1.7e-02
ovarian cancer 1.100 1.0e-04
pancreatic cancer -1.100 1.5e-02
pancreatic carcinoma -1.100 1.5e-02
pituitary cancer 1.200 2.7e-02
posterior fossa group A ependymoma 1.300 7.6e-04
primitive neuroectodermal tumor -2.300 1.9e-04
spina bifida -1.171 4.5e-02
tuberculosis -1.700 1.0e-05

Gene RIF (3)

AA Sequence

MARRGKKPVVRTLEDLTLDSGYGGAADSVRSSNLSLCCSDSHPASPYGGSCWPPLADSMHSRHNSFDTVN      1 - 70
TALVEDSEGLDCAGQHCSRLLPDLDEVPWTLQELEALLLRSRDPRAGPAVPGGLPKDALAKLSTLVSRAL     71 - 140
VRIAKEAQRLSLRFAKCTKYEIQSAMEIVLSWGLAAHCTAAALAALSLYNMSSAGGDRLGRGKSARCGLT    141 - 210
FSVGRVYRWMVDSRVALRIHEHAAIYLTACMESLFRDIYSRVVASGVPRSCSGPGSGSGSGPGPSSGPGA    211 - 280
APAADKEREAPGGGAASGGACSAASSASGGSSCCAPPAAAAAAVPPAAAANHHHHHHHALHEAPKFTVET    281 - 350
LEHTVNNDSEIWGLLQPYQHLICGKNASGVLCLPDSLNLHRDPQRSNKPGELPMFSQSELRTIEQSLLAT    351 - 420
RVGSIAELSDLVSRAMHHLQPLNAKHHGNGTPLHHKQGALYWEPEALYTLCYFMHCPQMEWENPNVEPSK    421 - 490
VNLQVERPFLVLPPLMEWIRVAVAHAGHRRSFSMDSDDVRQAARLLLPGVDCEPRQLRADDCFCASRKLD    491 - 560
AVAIEAKFKQDLGFRMLNCGRTDLVKQAVSLLGPDGINTMSEQGMTPLMYACVRGDEAMVQMLLDAGADL    561 - 630
NVEVVSTPHKYPSVHPETRHWTALTFAVLHGHIPVVQLLLDAGAKVEGSVEHGEENYSETPLQLAAAVGN    631 - 700
FELVSLLLERGADPLIGTMYRNGISTTPQGDMNSFSQAAAHGHRNVFRKLLAQPEKEKSDILSLEEILAE    701 - 770
GTDLAETAPPPLCASRNSKAKLRALREAMYHSAEHGYVDVTIDIRSIGVPWTLHTWLESLRIAFQQHRRP    771 - 840
LIQCLLKEFKTIQEEEYTEELVTQGLPLMFEILKASKNEVISQQLCVIFTHCYGPYPIPKLTEIKRKQTS    841 - 910
RLDPHFLNNKEMSDVTFLVEGRPFYAHKVLLFTASPRFKALLSSKPTNDGTCIEIGYVKYSIFQLVMQYL    911 - 980
YYGGPESLLIKNNEIMELLSAAKFFQLEALQRHCEIICAKSINTDNCVDIYNHAKFLGVTELSAYCEGYF    981 - 1050
LKNMMVLIENEAFKQLLYDKNGEGTGQDVLQDLQRTLAIRIQSIHLSSSKGSVV                   1051 - 1104
//

Text Mined References (10)

PMID Year Title