Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MEIDGFQQLDLEKSVPSKKTTPKRIIHFVDGDIMEEYSTEEEEEEEKEEQSTNSTLDPSKLSWGPYLRFW      1 - 70
AGRIASTSFSTCEFLGGRFAVFFGLTQPKYQYVLNEFYRIQNKKSDNKSERRGSKAQAAEVPNEKCHLEA     71 - 140
GVQEYGTIQQDVTEAIPQ                                                        141 - 158
//

Text Mined References (3)

PMID Year Title
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.