Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung adenocarcinoma 2714 3.38253328265531E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00295277579712989
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0200535768487661
uncontrolled asthma 67 0.0215062997974724

Expression

AA Sequence

MEIDGFQQLDLEKSVPSKKTTPKRIIHFVDGDIMEEYSTEEEEEEEKEEQSTNSTLDPSKLSWGPYLRFW      1 - 70
AGRIASTSFSTCEFLGGRFAVFFGLTQPKYQYVLNEFYRIQNKKSDNKSERRGSKAQAAEVPNEKCHLEA     71 - 140
GVQEYGTIQQDVTEAIPQ                                                        141 - 158
//

Text Mined References (3)

PMID Year Title
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.