Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.48
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
posterior fossa group B ependymoma 416 4.6e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Cognitive disorder 50 0.0 0.8

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.800 4.6e-05

 Compartment GO Term (1)

AA Sequence

MFHGTVTEELTSHEEWSHYNENIREGQKDFVFVKFNGLHLKSMENLQSCISLRVCIFSNNFITDIHPLQS      1 - 70
CIKLIKLDLHGNQIKSLPNTKFWNGLKNLKLLYLHDNGFAKLKNICVLSACPTLIALTMFDCPVSLKKGY     71 - 140
RHVLVNSIWPLKALDHHVISDEEIIQNWHLPERFKACNHRLFFNFCPALRKGTTYEEEINNIKHITSKIN    141 - 210
AILAHNSPVLIVQRWIRGFLVRKNLSPVFFHKKKQQEKIIRGYEAKWIYITKGYEDKLLKDLFFKPETNI    211 - 280
KGKLAYWKHNIYYPVDLKNSSEHRKHVSSILCELKPKDLGMKSKTSRHLIQKGQESEDEIVDEKLDTSFR    281 - 350
ISVFKLPIYTSGSLKNNAVLREKKQHFFPAYPQPIYTTHPKPIIKKDIRLERSMKEFFAPQRAGMKLRTF    351 - 420
SDIDKYYTEQKKQEYHKEKVRVVAMAQVARERVRVAVNEHLNQKKYATQKLIEENKETIQNSLRQVWQNR    421 - 490
FNYLEKARERKALFLKEKSQKASERLLVQNLNNERTLLTRGLLKIDRLEKNEAVLKEKSLIVKQKLKAEK    491 - 560
YRKNLLKEMKKVRSQEIYKRHCEEKFVMDMIAFEKACERLQDAKTKVAIVKTNLDFKVPNGLIK          561 - 624
//

Text Mined References (10)

PMID Year Title