Property Summary

NCBI Gene PubMed Count 6
PubMed Score 10.14
PubTator Score 4.65

Knowledge Summary

Patent

No data available

Gene RIF (3)

AA Sequence

MERFVRVPYGLYQGYGSTVPLGQPGLSGHKQPDWRQNMGPPTFLARPGLLVPANAPDYCIDPYKRAQLKA      1 - 70
ILSQMNPSLSPRLCKPNTKEVGVQVSPRVDKAVQCSLGPRTLSSCSPWDGRDPQEPLPACGVTSPATGRR     71 - 140
GLIRLRRDGDEAESKALPGPAEASQPQPPSRRSGADRQEEPGQLEESGEKDAPCPQETKSKQVPGDAASE    141 - 210
PLRRPNFQFLEPKYGYFHCKDCKTRWESAYVWCISGTNKVYFKQLCCKCQKSFNPYRVEAIQCQTCSKSH    211 - 280
CSCPQKKRHIDLRRPHRQELCGRCKDKRFSCGNIYSFKYVM                                 281 - 321
//

Text Mined References (7)

PMID Year Title