Property Summary

NCBI Gene PubMed Count 6
PubMed Score 8.17
PubTator Score 4.65

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession A6NP61 B2RV03 B7ZBU2
Symbols ZAR2
Z3CXXC7

Gene

 GO Component (1)

 Compartment GO Term (1)

Gene RIF (3)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20202217 BRCA2 gene promoter has bi-directional activity, expressing BRCA2 and a novel C4-type zinc finger containing transcription factor ZAR2.
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MERFVRVPYGLYQGYGSTVPLGQPGLSGHKQPDWRQNMGPPTFLARPGLLVPANAPDYCIDPYKRAQLKA      1 - 70
ILSQMNPSLSPRLCKPNTKEVGVQVSPRVDKAVQCSLGPRTLSSCSPWDGRDPQEPLPACGVTSPATGRR     71 - 140
GLIRLRRDGDEAESKALPGPAEASQPQPPSRRSGADRQEEPGQLEESGEKDAPCPQETKSKQVPGDAASE    141 - 210
PLRRPNFQFLEPKYGYFHCKDCKTRWESAYVWCISGTNKVYFKQLCCKCQKSFNPYRVEAIQCQTCSKSH    211 - 280
CSCPQKKRHIDLRRPHRQELCGRCKDKRFSCGNIYSFKYVM                                 281 - 321
//

Text Mined References (7)

PMID Year Title
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20202217 2010 Cell cycle-dependent regulation of the bi-directional overlapping promoter of human BRCA2/ZAR2 genes in breast cancer cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18442940 2008 A putative protein structurally related to zygote arrest 1 (Zar1), Zar1-like, is encoded by a novel gene conserved in the vertebrate lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.