Knowledge Summary

Patent

No data available

Synonym

Accession A6NNZ2
Symbols

Gene

AA Sequence

MREIVLTQTGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHLQLERINVHHHEASGGRYVPRAVLVDLEP      1 - 70
GTMDSVHSGPFGQVFRPDNFISGQCGAGNNWAKGRYTEGAELTESVMDVVRKEAESCDCLQGFQLTHSLG     71 - 140
GGTGSGMGTLLISKIREEYPDRIINTFSILPSPKVSDTVVEPYNATLSVHQLIENADETFCIDNEALYDI    141 - 210
CSRTLKLPTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ    211 - 280
YRALTVAELTQQMFDAKNMMAACDPRHGCYLTVAAIFRGRMPMREVDEQMFNIQDKNSSYFADWFPDNVK    281 - 350
TAVCDIPPRGLKMSATFIGNNAAIQELFTCVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS    351 - 420
EYQQYQDATAEEEEDEEYAEEEVA                                                  421 - 444
//

Text Mined References (4)

PMID Year Title
26875866 2016 Graded Control of Microtubule Severing by Tubulin Glutamylation.
19524510 2009 Evolutionary divergence of enzymatic mechanisms for posttranslational polyglycylation.
16371510 2006 Microtubule regulation in mitosis: tubulin phosphorylation by the cyclin-dependent kinase Cdk1.
16177791 2005 DNA sequence and analysis of human chromosome 18.