Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
nasopharyngeal carcinoma 1056 8.54515885329475E-8
posterior fossa group B ependymoma 1530 3.02803954120451E-4
astrocytic glioma 2241 0.00330992057402142
sonic hedgehog group medulloblastoma 1482 0.00331008923915382
invasive ductal carcinoma 2950 0.0429038990195878

Expression

  Differential Expression (5)

AA Sequence

METLPGLLQRPDPGALSAAQLEQLRKFKIQTRIANEKYLRTHKEVEWLISGFFREIFLKRPDNILEFAAD      1 - 70
YFTDPRLPNKIHMQLIKDKKAA                                                     71 - 92
//

Text Mined References (4)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.