Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.500 3.3e-03
invasive ductal carcinoma 1.200 4.3e-02
nasopharyngeal carcinoma -1.300 8.5e-08
posterior fossa group B ependymoma 1.400 3.0e-04
sonic hedgehog group medulloblastoma -1.100 3.3e-03

AA Sequence

METLPGLLQRPDPGALSAAQLEQLRKFKIQTRIANEKYLRTHKEVEWLISGFFREIFLKRPDNILEFAAD      1 - 70
YFTDPRLPNKIHMQLIKDKKAA                                                     71 - 92
//

Text Mined References (4)

PMID Year Title