Property Summary

NCBI Gene PubMed Count 1
PubMed Score 1.85
PubTator Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Infertility, Male 46 0.0 0.0
Disease Target Count
Male infertility 206
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 0.8
Disease Target Count Z-score Confidence
Cysticercosis 14 3.74 1.9

Expression

AA Sequence

MEEEGGGRSCGTTRELQKLKQQAMEYYRENDVPRRLEELLNSTFYLQPADVYGHLKANCFSKLAKPPTIC      1 - 70
KIVGKDVLDGLGLPTLQVDIFCTIQNFPKNVCSVVISTHFEVHENALPELAKAEEAERASAVSTAVQWVN     71 - 140
STITHELQGMAPSDQAEVDHLLRIFFASKVQEDKGRKELEKSLEYSTVPTPLPPVPPPPPPPPPTKKKGQ    141 - 210
KPGRKDTITEKPIAPAEPVEPVLSGSMAIGAVSLAVAKACAMLLNKPLYLNIALLKHNQEQPTTLSMPLL    211 - 280
MVSLVSCGKSSSGKLNLMKEVICIPHPELTTKQGVEMLMEMQKHINKIIEMMPPSPPKAETKKGHDGSKR    281 - 350
GQQQITGKMSHLGCLTINCDSIEQPLLLIQEICANLGLELGTNLHLAINCAGHELMDYNKGKYEVIMGTY    351 - 420
KNAAEMVDLYVDLINKYPSIIALIDPFRKEDSEQWDSIYHALGSRCYIIAGTASKSISKLLEQGNISIPK    421 - 490
SNGLIIKHTNQTTMSDLVEITNLIDSKKHITVFGSTEGESSDDSLVDLAVGLGVRFIKLGGLSRGERVTK    491 - 560
YNRLLTIEEELVQNGTLGFKEEHTFFYFNEEAEKAAEALEAAAAREPLVPTFPTQGVEESAETGASSG      561 - 628
//

Text Mined References (3)

PMID Year Title