Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 1.2e-29
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 184 0.0 1.2

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 1.2e-29

AA Sequence

MSFSLTFTELANIAIPQCGVLNFKALHLLLHGILEHIHMAELKKVLSGDEDFLQTSQVVIMPREGDAQPI      1 - 70
LNPMKRLSNVFDHVVSRLDKLENQLALLQDLPSTAQLLEASQGTARPVQDLWHLIKLRKMVEGHDEVMAK     71 - 140
SMQTLQDLLTDLHALQVTITALRKEVDMLKNMLDKVHPERMDIFAEDFKIQNWKMVALQREVASLQNKFK    141 - 210
TIPKTEDMVLWSGLHDAMFTSEIGSSPLDLWQSVEQLPEAALAQTTKYLEATRAIQVSEPVQNPQLLQTV    211 - 280
WHYEVPELLPEGSSAQAVSLSRAQEPAQPPALTPESAPGCTTEFAPGPAPGTEPVPGLELGLELEPVPAL    281 - 350
GPVPGPSVTPGSLPAPWPVLGPVPAPGAQPPPLGDWPALPRRWPLPQGWPRVGSWPLWDLGVLRPTQPQP    351 - 420
SRAPPPATEFGSLWPRPLQPYQSRQGEALQLAAVQVKGEENDVPSLRGLRERARKDGAPKDRTRKDGVPK    421 - 490
DRGGKDVDPKDRAHKDDVPKDRGGKDVDPKDRAHKDDVPKDRGGKDGDPKDRVGKDGAPKEAQPKAPQSA    491 - 560
LHRLKTTAAIAAAAAAAYAAATSSAAQAAKVAAKFVKDAPATKMAAIATDTAAAGPLGVFADVLGAGPSR    561 - 630
GATESQILGDDSEIYEILSPSYSAASIGPDPALSQAMVATKQAMSPEDKKRAVKYSMSHIAQIPVKHDSL    631 - 700
KEEFAQLSCNLNQRLSYLANMGGPSSLGTTVDILQKKIGSLQKSRLKEEELERIWGNQIEMMKDRYITLD    701 - 770
KAVENLQIRMDEFKTLQAQIKRLEMNKVNKSTMEEELREKADRSALAGKASRVDLETVALELNEMIQGIL    771 - 840
FKVTIHEDSWKKAMEELSKDVNTKLVHSDLDPLKKEMEEVWKIVRKLLIEGLRLDPDSAAGFRRKLFKRV    841 - 910
KCISCDRPVEMMTGPQLITIRKAHLLSRLRPASANSCEYLQRQQMREQQWLQLQDLGIQEDCQQDWGDGP    911 - 980
QNATSLKCKSCNLLTLYPYGDPHVIDYDSAEVDILGVDGILYKGRVNSQRGAQPLAVAKELAAVKAPSPP    981 - 1050
SQSLYDRVHSSALFGAICPPLCPRSSACSAASGPHLTMPARPPSLPPLLLLPPLIPSLRDPQQAPGSTRL   1051 - 1120
SRAPHIESRVGRKPPEEPANP                                                    1121 - 1141
//

Text Mined References (2)

PMID Year Title