Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.41
PubTator Score 1.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Gene RIF (1)

PMID Text
22143674 The expression of DHRS7c, a novel endo/sarcoplasmic reticulum-localized a short chain dehydrogenase/reductase, is inversely correlated with adrenergic stimulation and heart failure development.

AA Sequence

MGVMAMLMLPLLLLGISGLLFIYQEVSRLWSKSAVQNKVVVITDAISGLGKECARVFHTGGARLVLCGKN      1 - 70
WERLENLYDALISVADPSKQTFTPKLVLLDLSDISCVPDVAKEVLDCYGCVDILINNASVKVKGPAHKIS     71 - 140
LELDKKIMDANYFGPITLTKALLPNMISRRTGQIVLVNNIQGKFGIPFRTTYAASKHAALGFFDCLRAEV    141 - 210
EEYDVVISTVSPTFIRSYHVYPEQGNWEASIWKFFFRKLTYGVHPVEVAEEVMRTVRRKKQEVFMANPIP    211 - 280
KAAVYVRTFFPEFFFAVVACGVKEKLNVPEEG                                          281 - 312
//

Text Mined References (5)

PMID Year Title
22143674 2012 DHRS7c, a novel cardiomyocyte-expressed gene that is down-regulated by adrenergic stimulation and in heart failure.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.