Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ependymoma 2514 3.41001482686645E-9
glioblastoma 5572 1.32496153362517E-6
pilocytic astrocytoma 3086 5.17785130746852E-5
atypical teratoid / rhabdoid tumor 4369 8.58971316974069E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 3.04875869432016E-4
adult high grade glioma 2148 6.36769616497397E-4
ovarian cancer 8492 9.18916745350723E-4
medulloblastoma 1524 9.39154489895899E-4
non primary Sjogren syndrome sicca 840 0.0152270802189871
astrocytic glioma 2241 0.017674050625564
subependymal giant cell astrocytoma 2287 0.018589770926254

Expression

  Differential Expression (11)

Synonym

Accession A6NNL5 B4DFB2
Symbols

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Fruitfly EggNOG Inparanoid

AA Sequence

MEALRRAHEVALRLLLCRPWASRAAARPKPSASEVLTRHLLQRRLPHWTSFCVPYSAVRNDQFGLSHFNW      1 - 70
PVQGANYHVLRTGCFPFIKYHCSKAPWQDLARQNRFFTALKVVNLGIPTLLYGLGSWLFARVTETVHTSY     71 - 140
GPITVYFLNKEDEGAMY                                                         141 - 157
//

Text Mined References (3)

PMID Year Title
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.