Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.300 6.4e-04
astrocytic glioma -1.200 1.8e-02
Astrocytoma, Pilocytic -1.200 6.2e-05
atypical teratoid / rhabdoid tumor -1.600 8.6e-05
ependymoma -1.500 2.2e-02
glioblastoma -1.500 1.3e-06
group 4 medulloblastoma -1.400 1.2e-03
intraductal papillary-mucinous adenoma (... -1.100 3.0e-04
non primary Sjogren syndrome sicca 1.400 1.5e-02
ovarian cancer 1.800 9.2e-04
subependymal giant cell astrocytoma -1.316 1.9e-02

AA Sequence

MEALRRAHEVALRLLLCRPWASRAAARPKPSASEVLTRHLLQRRLPHWTSFCVPYSAVRNDQFGLSHFNW      1 - 70
PVQGANYHVLRTGCFPFIKYHCSKAPWQDLARQNRFFTALKVVNLGIPTLLYGLGSWLFARVTETVHTSY     71 - 140
GPITVYFLNKEDEGAMY                                                         141 - 157
//

Text Mined References (3)

PMID Year Title