Property Summary

NCBI Gene PubMed Count 2
PubMed Score 3.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Clear cell sarcoma of kidney 6
Disease Target Count Z-score Confidence
Sarcoma 62 4.31 2.2
Mesenchymal cell neoplasm 7 3.463 1.7
Disease Target Count
Endometrial stromal sarcoma 15

Expression

Gene RIF (2)

AA Sequence

MEVKGPSGRSFCCESEGQFKSCLKRHTPSLLLPSSWKGNSGSCLMAEALHRTSPTPNSCPLPLPLCRMSG      1 - 70
VLCSRNLFTFKFSLFQLDSGASGEPGHSLGLTLGFSYCGNCQTAVVSAQPEGMASNGAYPVLGPGVTANP     71 - 140
GTSLSVFTALPFTTPAPGPAHGPLLVTAGAPPGGPLVLSTFPSTPLVTEQDGCGPSGAGASNVFVQMRTE    141 - 210
VGPVKAAQAQTLVLTQAPLVWQAPGALCGGVVCPPPLLLAAAPVVPVMAAQVVGGTQACEGGWSQGLPLP    211 - 280
PPPPPAAQLPPIVSQGNAGPWPQGAHGESSLASSQAKAPPDDSCNPRSVYENFRLWQHYKPLARRHLPQS    281 - 350
PDTEALSCFLIPVLRSLARRKPTMTLEEGLWRAMREWQHTSNFDRMIFYEMAEKFLEFEAEEEMQIQKSQ    351 - 420
WMKGPQCLPPPATPRLEPRGPPAPEVVKQPVYLPSKAGPKAPTACLPPPRPQRPVTKARRPPPRPHRRAE    421 - 490
TKARLPPPRPQRPAETKVPEEIPPEVVQEYVDIMEELLGPSLGATGEPEKQREEGKVKQPQEEDWTPPDP    491 - 560
GLLSYIDKLCSQKDFVTKVEAVIHPQFLEELLSPDPQMDFLALSQDLEQEEGLTLAQLVEKRLPPLKEKQ    561 - 630
HARAAPSRGTARLDSSSSKFAAGQGAERDVPDPQQGVGMETCPPQMTARDSQGRGRAHTGMARSEDSVVL    631 - 700
LGCQDSPGLRAAWPTSPPQDHRPTCPGVGTKDALDLPGGSPVRESHGLAQGSSEEEELPSLAFLLGSQHK    701 - 770
LLPWWLPQSPVPASGLLSPEKWGPQGTHQSPSAERRGLNLAPSPANKAKKRPLFGSLSPAEKTPYPGPGL    771 - 840
RVSGEQSLTWGLGGPSQSQKRKGDPLVSRKEKKQHCSQ                                    841 - 878
//

Text Mined References (3)

PMID Year Title