Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A6NNJ1
Symbols FAM90A9

Gene

 Compartment GO Term (1)

AA Sequence

MMARRDPKSWAKRLVRAQTLQKQRRAPVGPRAPPPDEEDPRLKCKNCGAFGHTARSTRCPMKCWKAALVP      1 - 70
ATLGKKEGKENLKPWKPRVEANPGPLNKDKGEKEERPRQQDPQRKALLHMFSGKPPEKPLPNGKGSTESS     71 - 140
DHLRVASGPMPVHTTSKRPRVDPVLADRSAAEMSGRGSVLASLSPLRKASLSSSSSLGPKERQTGAAADM    141 - 210
PQPAVRHQGREPLLVVKPTHSSPEGGCREVPQAASKTHGLLQAARPQAQDKRPAVTSQPCPPAATHSLGL    211 - 280
GSNLSFGPGAKRPAQAPIQACLNFPKKPRLGPFQIPESAIQGGELGAPENLQPPPAATELGPSTSPQMGR    281 - 350
RTPAQVPSVDRQPPHSTPCLPTAQACTMSHHSAASHDGAQPLRVLFRRLENGRWSSSLLAAPSFHSPEKP    351 - 420
GTFLAQSPHVSEKSEAPCVRVPPSVLYEDLQVSSSSEDSDSDLE                              421 - 464
//

Text Mined References (3)

PMID Year Title
18602769 2008 Analysis of the multi-copy gene family FAM90A as a copy number variant in different ethnic backgrounds.
17684299 2007 Characterization and evolution of the novel gene family FAM90A in primates originated by multiple duplication and rearrangement events.
16421571 2006 DNA sequence and analysis of human chromosome 8.