Property Summary

NCBI Gene PubMed Count 3
PubMed Score 3.00
PubTator Score 1.00

Knowledge Summary

Patent (37)

Gene RIF (1)

PMID Text
24999593 OR2AT4 is involved in human keratinocyte re-epithelialization during wound-healing processes

AA Sequence

MDATACNESVDGSPVFYLLGIPSLPETFFLPVFFIFLLFYLLILMGNALILVAVVAEPSLHKPMYFFLIN      1 - 70
LSTLDILFTTTTVPKMLSLFLLGDRFLSFSSCLLQMYLFQSFTCSEAFILVVMAYDRYVAICHPLHYPVL     71 - 140
MNPQTNATLAASAWLTALLLPIPAVVRTSQMAYNSIAYIYHCFCDHLAVVQASCSDTTPQTLMGFCIAMV    141 - 210
VSFLPLLLVLLSYVHILASVLRISSLEGRAKAFSTCSSHLLVVGTYYSSIAIAYVAYRADLPLDFHIMGN    211 - 280
VVYAILTPILNPLIYTLRNRDVKAAITKIMSQDPGCDRSI                                  281 - 320
//

Text Mined References (5)

PMID Year Title
24999593 2014 A synthetic sandalwood odorant induces wound-healing processes in human keratinocytes via the olfactory receptor OR2AT4.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.