Property Summary

NCBI Gene PubMed Count 3
PubMed Score 3.50
PubTator Score 1.00

Knowledge Summary

Patent (37)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Gene RIF (1)

AA Sequence

MDATACNESVDGSPVFYLLGIPSLPETFFLPVFFIFLLFYLLILMGNALILVAVVAEPSLHKPMYFFLIN      1 - 70
LSTLDILFTTTTVPKMLSLFLLGDRFLSFSSCLLQMYLFQSFTCSEAFILVVMAYDRYVAICHPLHYPVL     71 - 140
MNPQTNATLAASAWLTALLLPIPAVVRTSQMAYNSIAYIYHCFCDHLAVVQASCSDTTPQTLMGFCIAMV    141 - 210
VSFLPLLLVLLSYVHILASVLRISSLEGRAKAFSTCSSHLLVVGTYYSSIAIAYVAYRADLPLDFHIMGN    211 - 280
VVYAILTPILNPLIYTLRNRDVKAAITKIMSQDPGCDRSI                                  281 - 320
//

Text Mined References (5)

PMID Year Title