Knowledge Summary

Patent

No data available

AA Sequence

MPEQDKDPRVQENPDDQRTVPEVTGDARSAFWPLRDNGGPSPFVPRPGPLQTDLHAQSSEIRYNHTSQTS      1 - 70
WTSSSTKRNAISSSYSSTGGLPGLKQRRGPASSRCQLTLSYSKTVSEDRPQAVSSGHTRCEKGADTAPGQ     71 - 140
TIAPTGGSPRSQDSRPRRRKIPLLPRRRGEPLMLPPPLELGYRVTAEDLHLEKETAFQRINSALHVEDKA    141 - 210
IPDCRPSRPSHTLSSLATGASGGPPVSKAPTMDAQQDRPKSQDSLGLLAPLASAAEVPSTAPVSGKKHRP    211 - 280
PGPLFSSSDPLPATSYHSRDTAQVTSLIPATFTAASRDAGMRRTRSAPAAATAAPPPSTLNNTSGSLLNA    281 - 350
VDGGPSHFLASATAAARAQRSEVRYNQRSQTSRTRSCLKRNASSSSSSHSSTEGLQELKRRRGPASSHCQ    351 - 420
LAHSSSNTVSEDGPQAVSSGHRCENKAGTAPGQTLAPRGGSPRSQASRPHINSALYVEDKAISDCRPSRP    421 - 490
SHTLSSLATGASGGPPVSKAPTMDAQQDRPKSQDCLGLVAPLASAAEVPSTAPVSGKKHRPPGPLFSSSD    491 - 560
PLPATSSHSRDSAQVTSLIPATFTAASRDAGMRRTRPGTSAPAAAAAALPPSTLNPTSGSLLNAVDGGPS    561 - 630
HFLASATAAARAQRSEVRYNQRSQTSRTRSCLKRNASSSSHSSTEGLQELKRRRGPASSHCQLAHSSSNT    631 - 700
VSEDGPQAVSSGHRCENKAGTAPGQTLAPRGGYPRSQASRPRINSALHVEDKAISDCRPSRPSHTLSSLA    701 - 770
TGASGGPPVSKAPTMDAQQDRPKSQDCLGLLAPLASAAEVSSTAPVSGKKHRPPGPLFSSSDPLPATSSH    771 - 840
SGDSAQDTSLIPAPFTPASRDAGIRRMFRVRNCLRGLGLFLLVFSFFFLLTWASFSF                 841 - 897
//

Text Mined References (5)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
8764824 1996 Novel transcribed sequences represented in the complex genomic region 5q13.
7818533 1995 Identification of multiple transcribed sequences from the spinal muscular atrophy region of human chromosome 5.