Property Summary

NCBI Gene PubMed Count 3
Grant Count 16
R01 Count 11
Funding $2,927,093.84
PubMed Score 23.41
PubTator Score 7.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Acquired immunodeficiency syndrome 164 1.0

Expression

AA Sequence

MFYFHCPPQLEGTATFGNHSSGDFDDGFLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFTREELAMKI      1 - 70
NLTEARVQVWFQNRRAKWRKTERGASDQEPGAKEPMAEVTPPPVRNINSPPPGDQARSKKEALEAQQSLG     71 - 140
RTVGPAGPFFPSCLPGTLLNTATYAQALSHVASLKGGPLCSCCVPDPMGLSFLPTYGCQSNRTASVATLR    141 - 210
MKAREHSEAVLQSANLLPSTSSSPGPVAKPAPPDGSQEKTSPTKEQSEAEKSV                     211 - 263
//

Text Mined References (4)

PMID Year Title
22394158 2012 Genome-wide association analysis of Sasang constitution in the Korean population.
22228203 2012 A genome-wide association study of inflammatory biomarker changes in response to fenofibrate treatment in the Genetics of Lipid Lowering Drug and Diet Network.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
7496632 1995 Identification by differential RT-PCR of a novel paired homeodomain protein specifically expressed in sensory neurons and a subset of their CNS targets.