Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.83
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ependymoma 2514 2.11133481278756E-13
pilocytic astrocytoma 3086 1.63514714525706E-6
atypical teratoid / rhabdoid tumor 4369 1.06934392010864E-5
glioblastoma 5572 7.03921623315509E-5
adult high grade glioma 2148 2.21315452797128E-4
medulloblastoma, large-cell 6234 8.11653218283368E-4
adrenocortical carcinoma 1427 0.00470474386771728
subependymal giant cell astrocytoma 2287 0.0275639997370572

Expression

  Differential Expression (8)

Disease log2 FC p
ependymoma -1.600 0.000
glioblastoma -1.400 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
medulloblastoma, large-cell -1.400 0.001
adrenocortical carcinoma 1.262 0.005
adult high grade glioma -1.300 0.000
pilocytic astrocytoma -1.200 0.000
subependymal giant cell astrocytoma -1.139 0.028

AA Sequence

MSSTVNNGAASMQSTPDAANGFPQPSSSSGTWPRAEEELRAAEPGLVKRAHREILDHERKRRVELKCMEL      1 - 70
QEMMEEQGYSEEEIRQKVGTFRQMLMEKEGVLTREDRPGGHIVAETPRLTEGAEPGLEYAPFDDDDGPVD     71 - 140
CDCPASCYRGHRGYRTKHWSSSSASPPPKKKKKKKGGHRRSRKKRRLESECSCGSSSPLRKKKKSVKKHR    141 - 210
RDRSDSGSRRKRRHRSRSSKCKRKEKNKEKKRPHTESPGRRSHRHSSGSSHSPSLSSHYSDSRSPSRLSP    211 - 280
KHRDEGRKTGSQRSSGSRSPSPSGGSGWGSPQRNGGSGQRSGAHGGRPGSAHSPPDKPSSPSPRVRDKAA    281 - 350
AAAPTPPARGKESPSPRSAPSSQGRGGRAAGGAGRRRRRRRRRRRSRSSASAPRRRGRRRPRPAPPRGSS    351 - 420
RSLSRARSSSDSGSGRGAPGPGPEPGSERGHGGHGKRAKERPPRARPASTSPSPGAHGRRGGPEGKSSSR    421 - 490
SPGPHPRSWSSSRSPSKSRSRSAEKRPHSPSRSPSPKKPLSRDKDGEGRARHSEAEATRARRRSRSYSPI    491 - 560
RKRRRDSPSFMEPRRITSAASVLFHTTGPAPLPPPAA                                     561 - 597
//

Text Mined References (4)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.