Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.83
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adrenocortical carcinoma 1.262 4.7e-03
adult high grade glioma -1.300 2.2e-04
Astrocytoma, Pilocytic -1.200 4.6e-06
atypical teratoid / rhabdoid tumor -1.500 1.1e-05
ependymoma -1.600 2.1e-13
glioblastoma -1.100 2.9e-06
medulloblastoma, large-cell -1.400 8.1e-04
subependymal giant cell astrocytoma -1.139 2.8e-02

AA Sequence

MSSTVNNGAASMQSTPDAANGFPQPSSSSGTWPRAEEELRAAEPGLVKRAHREILDHERKRRVELKCMEL      1 - 70
QEMMEEQGYSEEEIRQKVGTFRQMLMEKEGVLTREDRPGGHIVAETPRLTEGAEPGLEYAPFDDDDGPVD     71 - 140
CDCPASCYRGHRGYRTKHWSSSSASPPPKKKKKKKGGHRRSRKKRRLESECSCGSSSPLRKKKKSVKKHR    141 - 210
RDRSDSGSRRKRRHRSRSSKCKRKEKNKEKKRPHTESPGRRSHRHSSGSSHSPSLSSHYSDSRSPSRLSP    211 - 280
KHRDEGRKTGSQRSSGSRSPSPSGGSGWGSPQRNGGSGQRSGAHGGRPGSAHSPPDKPSSPSPRVRDKAA    281 - 350
AAAPTPPARGKESPSPRSAPSSQGRGGRAAGGAGRRRRRRRRRRRSRSSASAPRRRGRRRPRPAPPRGSS    351 - 420
RSLSRARSSSDSGSGRGAPGPGPEPGSERGHGGHGKRAKERPPRARPASTSPSPGAHGRRGGPEGKSSSR    421 - 490
SPGPHPRSWSSSRSPSKSRSRSAEKRPHSPSRSPSPKKPLSRDKDGEGRARHSEAEATRARRRSRSYSPI    491 - 560
RKRRRDSPSFMEPRRITSAASVLFHTTGPAPLPPPAA                                     561 - 597
//

Text Mined References (4)

PMID Year Title