Property Summary

NCBI Gene PubMed Count 2
PubMed Score 3.53
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Peripheral Neuropathy 303

Gene RIF (1)

PMID Text
19657183 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSLNYIKNFYEGCVKPPTVIGQFHTLFFGSIRIFFLGVLGFAVYGNEALHFICDPDKREVNLFCYNQFRP      1 - 70
ITPQVSFSALQLVIVLVPGALFHLYAACKSINQECILQKPIYTIIYILSVLLRISLAAIAFWLQIYLFGF     71 - 140
QVKSLYLCDARSLGENMIIRCMVPEHFEKTIFLIAINTFTTITILLFVAEIFEIIFRRLYFPFRQ         141 - 205
//

Text Mined References (2)

PMID Year Title
18849090 2009 Mouse lens connexin23 (Gje1) does not form functional gap junction channels but causes enhanced ATP release from HeLa cells.
14574404 2003 The DNA sequence and analysis of human chromosome 6.