Property Summary

NCBI Gene PubMed Count 3
PubMed Score 3.69
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Peripheral Nervous System Diseases 52 0.0 0.0
Disease Target Count
Peripheral Neuropathy 134

Gene RIF (1)

AA Sequence

MSLNYIKNFYEGCVKPPTVIGQFHTLFFGSIRIFFLGVLGFAVYGNEALHFICDPDKREVNLFCYNQFRP      1 - 70
ITPQVSFSALQLVIVLVPGALFHLYAACKSINQECILQKPIYTIIYILSVLLRISLAAIAFWLQIYLFGF     71 - 140
QVKSLYLCDARSLGENMIIRCMVPEHFEKTIFLIAINTFTTITILLFVAEIFEIIFRRLYFPFRQ         141 - 205
//

Text Mined References (3)

PMID Year Title