Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
posterior fossa group B ependymoma 1,530

Synonym

Accession A6NN90
Symbols hCG40743

Gene

 Compartment GO Term (1)

AA Sequence

MAHEGSRQVRDRGVTRSKAEKVRPPTVPVPQVDIVPGRLSEAEMALTALEEGEDVVGDILADLLARVMDS      1 - 70
AFKVYLTQQCIPFTISQAREAMLQITEWRFLARDEGESAVAEDPTWGEDEEPSACTTDSWAQGSVPVLHA     71 - 140
STSEGLENFQGEDPGGVDRIPLGRSWMGRGSQEQMESWEPSPQLRVTSAPPPTSELFQEAGPGGPVEEAD    141 - 210
GQSRGLSSAGSLSASFQLSVEEAPADDADPSLDPYLVASPQASTGRGHPLGFHLSLEDLYCCMPQLDAAG    211 - 280
DRLELRSEGVPCIASGVLVSYPSVGGATRPSASCQQQRAGHSDVRLSAHHHRMRRKAAVKRLDPARLPCH    281 - 350
WVRPLAEVLVPDSQTRPLEAYRGRQRGEKTKARAEPQALGPGTRVSPAAFFPLRPGIPFRDLDSGPALLF    351 - 420
PTLNLGLSSPSLESKLPLPNSRIRFLTTHPVLPDVARSRSPKLWPSVRWPSGWEGKAELLGELWAGRTRV    421 - 490
PPQGLELADREGQDPGRWPRTTPPVLEATSQVMWKPVLLPEALKLAPGVSMWNRSTQVLLSSGVPEQEDK    491 - 560
EGSTFPPVEQHPIQTGAPKPR                                                     561 - 581
//

Text Mined References (1)

PMID Year Title
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.