Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A6NN73
Symbols GOLGA8C

Gene

PANTHER Protein Class (1)

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MAEETRQSKLAAAKRKLKEYWQRNSPGVPAGAKRNRKTNGSIHETATSGGCHSPGDSSSTSSSLHAPQSP      1 - 70
CQELAVVPDSRSVKVSQLKNTIKSLKQQKKQVEHQLEEEKKANNEKQKAERGLEVQIQRLNIQKGKLNTD     71 - 140
LYHTKRSLRYFEEESKDLAVRLQHSLQRKGELERALSAVTATQKKKAERFSSRSKARMEWKLEQSMREQA    141 - 210
LLKAQLTQLKESLKEVQLERDEYAEHLKGERARWQQRMRKMSQEVCSLKKEKKHDKYRVETLERSLSKLK    211 - 280
HQMAEPLPPEPPAVPSEVELQHLRKELERVAGALQAQVEYNQRISLLNEGQKERLREQEERLQEQQERLR    281 - 350
EQEERLQQLAEPQNSFKELNNENKSVLQLEQQVKELQEKLGKRLAHPVASAQKEPEAAVPAPGPGGESSG    351 - 420
FMDHLEEKADLSELVEKEELGFFQYYRERCHQKVYHPITKPGGSAKDAAPGGGHHQAGPGQGGDEGEAAG    421 - 490
AAGDGVAAGGDYKGHSKFLVTAQNPAHEPSPGAPAPQELGAAHKHGDLCEVSLTDSVEPVQGETREGSPH    491 - 560
DKPTAQPIVQDHQEHPGLGSNCCVPFFCWAWPPRRRR                                     561 - 597
//

Text Mined References (4)

PMID Year Title