Knowledge Summary

Patent

No data available

Synonym

Accession A6NN06 A1A4A6 B7WNL3 Q96BV1
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MRKLRLRASNPGPSGAPGTRRHFSTSGGGHHCGRRWLRRVRRSRSQTPSCQNLDPNPPIARFPLPLERIS      1 - 70
EVPRRACLHGRDASSVWPPPERSD                                                   71 - 94
//

Text Mined References (2)

PMID Year Title