Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MNNVIEFILLGLTHNPELQKFLFVMFLITYLITLAGNLFISVIIFISPALGSPMYSFPSYLFIIDIFCSS      1 - 70
SIAPKMNFDLISEKNTISFNGCMTQLFTEHFFYYYYYYTLTEIILLSVMAYDHYVAIRKPLHYATIMSQP     71 - 140
MCGFLMVVAGILGFVHGGIQTLFIAQLPFCGPNVINHFMCDLVPLLELACTDTHTLGPLIAANSGSLCFL    141 - 210
IFSMLVASYVIILCFLRTHSSEGRRKALSSCASHIFIVILFFVPFSYLYLRPTSFPTDKAVTVFCTLFTP    211 - 280
MLNPLIYTLKNKEVKNVIKKLWKQIMTTDDK                                           281 - 311
//

Text Mined References (3)

PMID Year Title
21502573 2011 Genetic predictors of fibrin D-dimer levels in healthy adults.
18674749 2008 Extensive copy-number variation of the human olfactory receptor gene family.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.