Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.72
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 4.3e-03

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 4.3e-03

AA Sequence

MLAVEVSEAEGGIREWEEEEKEEEAAERTPTGEKSPNSPRTLLSLRGKARTGGPMEVKLELHPLQNRWAL      1 - 70
WFFKNDRSRAWQDNLHLVTKVDTVEDFWALYSHIQLASKLSSGCDYALFKDGIQPMWEDSRNKRGGRWLV     71 - 140
SLAKQQRHIELDRLWLETLLCLIGESFEEHSREVCGAVVNIRTKGDKIAVWTREAENQAGVLHVGRVYKE    141 - 210
RLGLSPKTIIGYQAHADTATKSNSLAKNKFVV                                          211 - 242
//

Text Mined References (5)

PMID Year Title