Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.74
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 0.00428860345043082

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 0.004

Synonym

Accession A6NMX2
Symbols

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG
C. elegans OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

AA Sequence

MLAVEVSEAEGGIREWEEEEKEEEAAERTPTGEKSPNSPRTLLSLRGKARTGGPMEVKLELHPLQNRWAL      1 - 70
WFFKNDRSRAWQDNLHLVTKVDTVEDFWALYSHIQLASKLSSGCDYALFKDGIQPMWEDSRNKRGGRWLV     71 - 140
SLAKQQRHIELDRLWLETLLCLIGESFEEHSREVCGAVVNIRTKGDKIAVWTREAENQAGVLHVGRVYKE    141 - 210
RLGLSPKTIIGYQAHADTATKSNSLAKNKFVV                                          211 - 242
//

Text Mined References (5)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16191198 2005 Phylogenetic analysis of eIF4E-family members.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.