Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 0.25

Knowledge Summary

Patent

No data available

AA Sequence

MALPITNGTLFMPFVLTFIGIPGFESVQCWIGIPFCATYVIALIGNSLLLIIIKSEPSLHEPMYIFLATL      1 - 70
GATDISLSTSIVPKMLDIFWFHLPEIYFDACLFQMWLIHTFQGIESGVLLAMALDRCVAICYPLRRAIVF     71 - 140
TRQLVTYIVVGVTLRPAILVIPCLLLIKCHLKLYRTKLIYHTYCERVALVKLATEDVYINKVYGILGAFI    141 - 210
VGGLDFIFITLSYIQIFITVFHLPLKEARLKVFNTCIPHIYVFFQFYLLAFFFIFYSQIWILYPIICTYH    211 - 280
LVQSLPTGPTIPQPLYLWVKDQTH                                                  281 - 304
//

Text Mined References (4)

PMID Year Title
16939646 2006 A probabilistic classifier for olfactory receptor pseudogenes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.