Property Summary

NCBI Gene PubMed Count 2
Grant Count 24
R01 Count 11
Funding $2,534,737.67
PubMed Score 29.53
PubTator Score 3.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
AMYOTROPHIC LATERAL SCLEROSIS 1 49

Gene RIF (1)

PMID Text
21048147 Dbx1-derived neurons are essential for the transgenic expression and generation of respiratory behavior both in vitro and in vivo.

AA Sequence

MMFPGLLAPPAGYPSLLRPTPTLTLPQSLQSAFSGHSSFLVEDLIRISRPPAYLPRSVPTASMSPPRQGA      1 - 70
PTALTDTGASDLGSPGPGSRRGGSPPTAFSPASETTFLKFGVNAILSSGPRTETSPALLQSVPPKTFAFP     71 - 140
YFEGSFQPFIRSSYFPASSSVVPIPGTFSWPLAARGKPRRGMLRRAVFSDVQRKALEKMFQKQKYISKPD    141 - 210
RKKLAAKLGLKDSQVKIWFQNRRMKWRNSKERELLSSGGCREQTLPTKLNPHPDLSDVGQKGPGNEEEEE    211 - 280
GPGSPSHRLAYHASSDPQHLRDPRLPGPLPPSPAHSSSPGKPSDFSDSEEEEEGEEQEEITVS           281 - 343
//

Text Mined References (3)

PMID Year Title
21048147 2010 Developmental origin of preBötzinger complex respiratory neurons.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
11239429 2001 Control of interneuron fate in the developing spinal cord by the progenitor homeodomain protein Dbx1.