Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent (29)

AA Sequence

MARENHSLAAEFILIGFTNYPELKTLLFVVFSAIYLVTMVGNLGLVALIYVERRLLTPMYIFLGNLALMD      1 - 70
SCCSCAVTPKMLENFFSEDRIISLYECMAQFYFLCLAETTDCFLLATMAYDRYVAICHPLQYHTMMSKTL     71 - 140
CIRMTTGAFKAGNLHSMIHVGLLLRLTFCRSNKIHHFFCDILPLYRLSCTDPSINELMIYIFSIPIQIFT    141 - 210
IATVLISYLCILLTVFKMKSKEGRGKAFSTCASHFLSVSIFYICLLMYIGPSEEGDKDTPVAIFYAIVIP    211 - 280
LLNPFIYSLRNKEVINVLKKIMRNYNILKQTCSIANLFLIY                                 281 - 321
//

Text Mined References (1)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.