Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.78

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession A6NMN3 Q86WY6 Q8N6K8
Symbols C10orf73

Gene

AA Sequence

MKCYFTDHRGEQSPTDGTTLSLTSPESTEESVEVFWPGTIQREGSSPRPGPAIPREEGLYFAARDRGMRD      1 - 70
WSSSPSSESSEYQSYSQYQSCCSCMCDEDNAAPQSVCAFYTHVQTVRGVAVAWETEAGFEPVTRKPRIHE     71 - 140
AQFIKRQRWNGSSFEMASNTDMRWDLEACKSNCSPEPEDIDLLECCLQELREPPDWLVTTNYGVRCVACC    141 - 210
RVLPSLDALLEHAQHGIREGFSCQIFFEEMLERRRAQGQAHDQQLEEEQSPSDNSECSRPQGEVLSAQQQ    211 - 280
EKQ                                                                       281 - 283
//

Text Mined References (4)

PMID Year Title
26179146 2015 FAM170B, a novel acrosomal protein involved in fertilization in mice.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.