Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.73
PubTator Score 2.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma -1.400 2.1e-03
lung carcinoma -2.600 1.3e-06
non-small cell lung carcinoma -1.600 7.2e-09
ovarian cancer -1.600 1.3e-06

Synonym

Accession A6NML5
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MKGLYQAAGRILVTLGILSVCSGVIAFFPVFSYKPWFTGWSVRIACPIWNGALAITTGVLLLLAYREWTQ      1 - 70
RYLGEATFTFVILSIMGCPLHFAIALESALLGPYCFYSFSGIAGTNYLGYAVTFPYPYAKFPLACVDPPH     71 - 140
YEEYHLTLQALDLCLSFTLLCTSLTVFIKLSARLIQNGHINMQLPAGNPNPFSP                    141 - 194
//

Text Mined References (7)

PMID Year Title