Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.73
PubTator Score 2.58

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
22828495 The specialized function of this brain region suggests that TMEM212 could contribute to the innate architecture of face processing.

AA Sequence

MKGLYQAAGRILVTLGILSVCSGVIAFFPVFSYKPWFTGWSVRIACPIWNGALAITTGVLLLLAYREWTQ      1 - 70
RYLGEATFTFVILSIMGCPLHFAIALESALLGPYCFYSFSGIAGTNYLGYAVTFPYPYAKFPLACVDPPH     71 - 140
YEEYHLTLQALDLCLSFTLLCTSLTVFIKLSARLIQNGHINMQLPAGNPNPFSP                    141 - 194
//

Text Mined References (7)

PMID Year Title
22828495 2012 Genetic variants affecting the neural processing of human facial expressions: evidence using a genome-wide functional imaging approach.
22566498 2012 Genomic association analysis identifies multiple loci influencing antihypertensive response to an angiotensin II receptor blocker.
21701570 2012 Genome-wide association of BMI in African Americans.
20889312 2010 A genome-wide meta-analysis identifies novel loci associated with schizophrenia and bipolar disorder.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.