Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession A6NMK8
Symbols C5orf57

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAQQNMKVRPVLLKRNSLESVEFVKQPHHRRSKSQQVRFKEDGTTKNPTGLAEVDVQTPEDPAVMGKTQA      1 - 70
TRHHLPPTYSLSFPRSQKAGGFRNIAIQTSPSLRKHFPVFKRKRLTASKSLVEMPTASQSAIQVNGNLSE     71 - 140
QDIVSSDLAYLRLAQHLEDGPRRVKVSHAFLPRVPKVQSNGPVSICLEAGTWRSLEKATAAIQVPDDIYH    141 - 210
SPSWEARESALSPDRSAEVSNSIHPLDDTRPGDGRRVTPLDSEKSTSCLNATSVASHTPGTEELKPELLL    211 - 280
PKDNSDDKDLGSLSSQSKETCVPSSPRTHSSPSQGSHSQPAHPGRASDCPSSSNNHQNLVSLKTNSASKS    281 - 350
APGCQEQTANNPTESDTLEFPNCPGSNHLPSSLSRSETKLQSNREISDINQIHLARGELCDLQGRLQSVE    351 - 420
ESLHSNQEKIKVLLNVIQDLEKARALTEGRNFYRTGQDLNNCSTCQNTACIIYSVEYDFRQQEGRFHEVL    421 - 490
QSLEEAEPVEEASPPPKSPAEPPAPEKQDLRRKTKKVKKKCFWWI                             491 - 535
//

Text Mined References (4)

PMID Year Title
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.