Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 6.6e-10

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.700 6.6e-10

Gene RIF (1)

AA Sequence

MQEVIAGLERFTFAFEKDVEMQKGTGLLPFQGMDKSASAVCNFFTKGLCEKGKLCPFRHDRGEKMVVCKH      1 - 70
WLRGLCKKGDHCKFLHQYDLTRMPECYFYSKFGDCSNKECSFLHVKPAFKSQDCPWYDQGFCKDGPLCKY     71 - 140
RHVPRIMCLNYLVGFCPEGPKCQFAQKIREFKLLPGSKI                                   141 - 179
//

Text Mined References (4)

PMID Year Title