Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.07
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 1.38978133314348E-13
acute quadriplegic myopathy 1157 1.98867940181048E-6
osteosarcoma 7933 5.72880862182572E-6
tuberculosis 1563 6.98672255303017E-6
medulloblastoma, large-cell 6234 2.12707533210994E-5
atypical teratoid / rhabdoid tumor 4369 3.52966288822536E-5
pilocytic astrocytoma 3086 2.18605930404778E-4
primitive neuroectodermal tumor 3031 0.0022076574073979
adrenocortical carcinoma 1427 0.00301394059388783

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 1.559 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
medulloblastoma, large-cell -1.400 0.000
primitive neuroectodermal tumor -1.100 0.002
acute quadriplegic myopathy 1.156 0.000
adrenocortical carcinoma -2.079 0.003
tuberculosis -1.500 0.000
pilocytic astrocytoma 1.100 0.000
psoriasis 1.600 0.000

Synonym

Accession A6NMD0 A6NEU7
Symbols DSPA3

Gene

  Ortholog (6)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Anole lizard OMA EggNOG

AA Sequence

MREGKRGPPCILSFRGTLERVEAQWELEAQGPGQCPAPLGDPASTTDGAQEARVPLDGAFWIPRPPAGSP      1 - 70
KGCFACVSKPPALQAPAAPAPEPSASPPMAPTLFPMESKSSKTDSVRAAGAPPACKHLAEKKTMTNPTTV     71 - 140
IEVYPDTTEVNDYYLWSIFNFVYLNFCCLGFIALAYSLKVRDKKLLNDLNGAVEDAKTARLFNITSSALA    141 - 210
ASCIILVFIFLRYPLTDY                                                        211 - 228
//

Text Mined References (6)

PMID Year Title
22363774 2012 The dispanins: a novel gene family of ancient origin that contains 14 human members.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.