Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.21
PubTator Score 1.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
acute quadriplegic myopathy 1.156 2.0e-06
adrenocortical carcinoma -2.079 3.0e-03
Astrocytoma, Pilocytic 1.100 2.1e-04
atypical teratoid / rhabdoid tumor -1.100 3.5e-05
medulloblastoma, large-cell -1.400 2.1e-05
osteosarcoma 1.559 5.7e-06
primitive neuroectodermal tumor -1.100 2.2e-03
psoriasis 1.600 1.4e-13
tuberculosis -1.500 7.0e-06

AA Sequence

MREGKRGPPCILSFRGTLERVEAQWELEAQGPGQCPAPLGDPASTTDGAQEARVPLDGAFWIPRPPAGSP      1 - 70
KGCFACVSKPPALQAPAAPAPEPSASPPMAPTLFPMESKSSKTDSVRAAGAPPACKHLAEKKTMTNPTTV     71 - 140
IEVYPDTTEVNDYYLWSIFNFVYLNFCCLGFIALAYSLKVRDKKLLNDLNGAVEDAKTARLFNITSSALA    141 - 210
ASCIILVFIFLRYPLTDY                                                        211 - 228
//

Text Mined References (6)

PMID Year Title