Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.07
PubTator Score 1.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 1.559 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
medulloblastoma, large-cell -1.400 0.000
primitive neuroectodermal tumor -1.100 0.002
acute quadriplegic myopathy 1.156 0.000
adrenocortical carcinoma -2.079 0.003
tuberculosis -1.500 0.000
pilocytic astrocytoma 1.100 0.000
psoriasis 1.600 0.000

AA Sequence

MREGKRGPPCILSFRGTLERVEAQWELEAQGPGQCPAPLGDPASTTDGAQEARVPLDGAFWIPRPPAGSP      1 - 70
KGCFACVSKPPALQAPAAPAPEPSASPPMAPTLFPMESKSSKTDSVRAAGAPPACKHLAEKKTMTNPTTV     71 - 140
IEVYPDTTEVNDYYLWSIFNFVYLNFCCLGFIALAYSLKVRDKKLLNDLNGAVEDAKTARLFNITSSALA    141 - 210
ASCIILVFIFLRYPLTDY                                                        211 - 228
//

Text Mined References (6)

PMID Year Title
22363774 2012 The dispanins: a novel gene family of ancient origin that contains 14 human members.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.