Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession A6NMA1
Symbols TRPC5-AS1

Gene

 Compartment GO Term (0)

AA Sequence

MDSVLIHVLIDGLVACVAQLIRIADELLQFILQVQEVPYVEENGRAEETEADAPLPEEPSLPDLPDLSDL      1 - 70
DSILTPREDEDLIFDIDQAMLDMDNLYEDTVSGINDDLTGD                                  71 - 111
//

Text Mined References (5)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.