Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession A6NMA1
Symbols TRPC5-AS1

Gene

 Compartment GO Term (0)

AA Sequence

MDSVLIHVLIDGLVACVAQLIRIADELLQFILQVQEVPYVEENGRAEETEADAPLPEEPSLPDLPDLSDL      1 - 70
DSILTPREDEDLIFDIDQAMLDMDNLYEDTVSGINDDLTGD                                  71 - 111
//

Text Mined References (5)

PMID Year Title