Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A6NM66
Symbols C21orf54

 Compartment GO Term (1)

AA Sequence

MLAKGAEEGRSGGPRPAITLPGSLHFTCDLKTSPYCLTRAELMEHLPLRVAVHSMSPCHRSCFCGELKRG      1 - 70
HPWNTPQVSSFPSSTTSLSHSCTTSHLDCSQQVESGSK                                     71 - 108
//

Text Mined References (4)

PMID Year Title