Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A6NM66
Symbols C21orf54

Gene

 Compartment GO Term (1)

AA Sequence

MLAKGAEEGRSGGPRPAITLPGSLHFTCDLKTSPYCLTRAELMEHLPLRVAVHSMSPCHRSCFCGELKRG      1 - 70
HPWNTPQVSSFPSSTTSLSHSCTTSHLDCSQQVESGSK                                     71 - 108
//

Text Mined References (4)

PMID Year Title
22228203 2012 A genome-wide association study of inflammatory biomarker changes in response to fenofibrate treatment in the Genetics of Lipid Lowering Drug and Diet Network.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
10830953 2000 The DNA sequence of human chromosome 21.