Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.93
PubTator Score 1.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Disease Z-score Confidence
Teratocarcinoma 8 3.374 1.7
Gout 93 1.0
psoriasis 6,685

Gene RIF (1)

PMID Text
12736707 CLDN21, clustered with CLDN22 at human chromosome 4q35.1, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

AA Sequence

MALIFRTAMQSVGLLLSLLGWILSIITTYLPHWKNLNLDLNEMENWTMGLWQTCVIQEEVGMQCKDFDSF      1 - 70
LALPAELRVSRILMFLSNGLGFLGLLVSGFGLDCLRIGESQRDLKRRLLILGGILSWASGITALVPVSWV     71 - 140
AHKTVQEFWDENVPDFVPRWEFGEALFLGWFAGLSLLLGGCLLNCAACSSHAPLALGHYAVAQMQTQCPY    141 - 210
LEDGTADPQV                                                                211 - 220
//

Text Mined References (9)

PMID Year Title
19706201 2009 The claudins.
18036336 2008 Structure and function of claudins.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
12736707 2003 CLDN23 gene, frequently down-regulated in intestinal-type gastric cancer, is a novel member of CLAUDIN gene family.
12475568 2003 Tight junction proteins.
12231346 2002 Claudin-based barrier in simple and stratified cellular sheets.
11283726 2001 Multifunctional strands in tight junctions.
11247307 2001 The roles of claudin superfamily proteins in paracellular transport.
10690502 2000 Tight junctions of the blood-brain barrier.