Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.06
PubTator Score 1.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 8.6e-11
Disease Target Count Z-score Confidence
Gout 104 0.0 1.9
Disease Target Count Z-score Confidence
Teratocarcinoma 8 3.399 1.7

Gene RIF (1)

AA Sequence

MALIFRTAMQSVGLLLSLLGWILSIITTYLPHWKNLNLDLNEMENWTMGLWQTCVIQEEVGMQCKDFDSF      1 - 70
LALPAELRVSRILMFLSNGLGFLGLLVSGFGLDCLRIGESQRDLKRRLLILGGILSWASGITALVPVSWV     71 - 140
AHKTVQEFWDENVPDFVPRWEFGEALFLGWFAGLSLLLGGCLLNCAACSSHAPLALGHYAVAQMQTQCPY    141 - 210
LEDGTADPQV                                                                211 - 220
//

Text Mined References (9)

PMID Year Title