Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Carcinoma 2,147 1.0

AA Sequence

MDSTVPSALELPQRLALNPRESPRSPEEEEPHLLSSLAAVQTLANVIRPCYGPHGRQKFLVTMKGETVCT      1 - 70
GCATAILRALELEHPAAWLLREAAQTQAENSGDGTAFVVLLTEALLEQAEQLLKFGLPRPQLREAYATAT     71 - 140
AEVLATLPSLAIQSLGPLEDPSWALHSVMNTHTLPPMNHLTKLVAHACWAIKELDGSFKPERVGVCTLHG    141 - 210
GTLEDSCLLQGLAISGKLCGQMAAVLSGARVALFACPFGPAHPNAPATACLSSPADLAQFSKGSDQLLEK    211 - 280
QVGQLAAAGINVAVVLGEVDEETLTLADKYGIVVIQARSRMEIIYLSEVLDTPLLPRLLPPQRPGKCQRV    281 - 350
YRQELGDGLAVVFEWECTGTPALTVVLRGATTQGLRSAEQAVYHSIDAYFQPCQDPRLIPGAGATEMALA    351 - 420
KMLSDKGSRLEGPNGPAFLAFARALKYLPKTLAENAGLAVSDVVAEMSGVHQGGNLLMGVGAEGIINVAQ    421 - 490
EGVWDTLIVKAQGFRAVAEVVLQLVTVDEIVVAKKSPTHQQIWNPDSKKTKKRPPPVEKKKILGMNN       491 - 557
//

Text Mined References (2)

PMID Year Title
20193073 2010 Chaperonin genes on the rise: new divergent classes and intense duplication in human and other vertebrate genomes.
12853948 2003 The DNA sequence of human chromosome 7.