Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 1.1303503529732E-67
ovarian cancer 8492 6.55089965653752E-8
group 3 medulloblastoma 2254 1.72669928112382E-5
osteosarcoma 7933 5.52632121214641E-5

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.278 0.000
group 3 medulloblastoma -1.600 0.000
ovarian cancer 1.300 0.000
psoriasis 1.900 0.000

Synonym

Accession A6NM28 Zfp-92
Symbols ZNF897

Gene

  Ortholog (1)

Species Source
Mouse OMA Inparanoid

AA Sequence

MAAILLTTRPKVPVSFEDVSVYFTKTEWKLLDLRQKVLYKRVMLENYSHLVSLGFSFSKPHLISQLERGE      1 - 70
GPWVADIPRTWATAGLHIGDRTQSKTSTSTQKHSGRQLPGADPQGGKEGQAARSSVLQRGAQGLGQSSAA     71 - 140
GPQGPKGAEKRYLCQQCGKAFSRSSNLIKHRIIHSGEKPYACPECGKLFRRSFALLEHQRIHSGEKPYAC    141 - 210
PECSKTFTRSSNLIKHQVIHSGERPFACGDCGKLFRRSFALLEHARVHSGERPYACPECGKAFSRSSNLI    211 - 280
EHQRTHRGEKPYACGQCAKAFKGVSQLIHHQRSHSGERPFACRECGKAFRGRSGLSQHRRVHSGEKPYEC    281 - 350
SDCGKAFGRRANLFKHQAVHGARRPAKAETARRLAGPGSTGPGSAVAATSPPRPSTAARPSRPSRR        351 - 416
//

Text Mined References (3)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.
10854409 2000 Comparative genome sequence analysis of the Bpa/Str region in mouse and Man.
9099879 1997 Expressed STSs and transcription of human Xq28.