Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.1e-67
ovarian cancer 8520 6.6e-08
group 3 medulloblastoma 4104 1.7e-05
osteosarcoma 7950 5.5e-05

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma -1.600 1.7e-05
osteosarcoma -1.278 5.5e-05
ovarian cancer 1.300 6.6e-08
psoriasis 1.900 1.1e-67

AA Sequence

MAAILLTTRPKVPVSFEDVSVYFTKTEWKLLDLRQKVLYKRVMLENYSHLVSLGFSFSKPHLISQLERGE      1 - 70
GPWVADIPRTWATAGLHIGDRTQSKTSTSTQKHSGRQLPGADPQGGKEGQAARSSVLQRGAQGLGQSSAA     71 - 140
GPQGPKGAEKRYLCQQCGKAFSRSSNLIKHRIIHSGEKPYACPECGKLFRRSFALLEHQRIHSGEKPYAC    141 - 210
PECSKTFTRSSNLIKHQVIHSGERPFACGDCGKLFRRSFALLEHARVHSGERPYACPECGKAFSRSSNLI    211 - 280
EHQRTHRGEKPYACGQCAKAFKGVSQLIHHQRSHSGERPFACRECGKAFRGRSGLSQHRRVHSGEKPYEC    281 - 350
SDCGKAFGRRANLFKHQAVHGARRPAKAETARRLAGPGSTGPGSAVAATSPPRPSTAARPSRPSRR        351 - 416
//

Text Mined References (3)

PMID Year Title