Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent (94)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 7.94104689857973E-4
diabetes mellitus 1663 0.00151642395682025

Synonym

Accession A6NM03
Symbols OR11-76
OR2AG2P

Gene

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Horse OMA Inparanoid

AA Sequence

MELRNSTLGSGFILVGILNDSGSPELLYATFTILYMLALTSNGLLLLAITIEARLHMPMYLLLGQLSLMD      1 - 70
LLFTSVVTPKALADFLRRENTISFGGCALQMFLALTMGSAEDLLLAFMAYDRYVAICHPLKYMTLMSPRV     71 - 140
CWIMVATSWILASLIAIGHTMYTMHLPFCVSWEIRHLLCEIPPLLKLACADTSRYELIIYVTGVTFLLLP    141 - 210
ISAIVASYTLVLFTVLRMPSNEGRKKALVTCSSHLIVVGMFYGAATFMYVLPSSFHSPKQDNIISVFYTI    211 - 280
VTPALNPLIYSLRNKEVMRALRRVLGKYILLAHSTL                                      281 - 316
//

Text Mined References (4)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.