Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent (94)

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 7.9e-04
diabetes mellitus 1728 1.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

AA Sequence

MELRNSTLGSGFILVGILNDSGSPELLYATFTILYMLALTSNGLLLLAITIEARLHMPMYLLLGQLSLMD      1 - 70
LLFTSVVTPKALADFLRRENTISFGGCALQMFLALTMGSAEDLLLAFMAYDRYVAICHPLKYMTLMSPRV     71 - 140
CWIMVATSWILASLIAIGHTMYTMHLPFCVSWEIRHLLCEIPPLLKLACADTSRYELIIYVTGVTFLLLP    141 - 210
ISAIVASYTLVLFTVLRMPSNEGRKKALVTCSSHLIVVGMFYGAATFMYVLPSSFHSPKQDNIISVFYTI    211 - 280
VTPALNPLIYSLRNKEVMRALRRVLGKYILLAHSTL                                      281 - 316
//

Text Mined References (4)

PMID Year Title