Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.5e-04

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.400 1.5e-04

AA Sequence

MAPGPWPVSCLRGGPLGLTYLSLLLIPAAAGTYCECSLGLSREALIALLVVLAGISASCFCALVIVAIGV      1 - 70
LRAKGETCPRQVDNRLVENFGVQEDLMDLHPVYVESQLMDADLEVSLVPPLEDQSLVAIPMEASSEEPPP     71 - 140
PPPLPPE                                                                   141 - 147
//

Text Mined References (1)

PMID Year Title