Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

AA Sequence

MAPGPWPVSCLRGGPLGLTYLSLLLIPAAAGTYCECSLGLSREALIALLVVLAGISASCFCALVIVAIGV      1 - 70
LRAKGETCPRQVDNRLVENFGVQEDLMDLHPVYVESQLMDADLEVSLVPPLEDQSLVAIPMEASSEEPPP     71 - 140
PPPLPPE                                                                   141 - 147
//

Text Mined References (1)

PMID Year Title
15164053 2004 DNA sequence and analysis of human chromosome 9.