Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.85
PubTator Score 1.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
facioscapulohumeral dystrophy 288 5.2e-19
Disease Target Count Z-score Confidence
Facioscapulohumeral muscular dystrophy 26 5.139 2.6

AA Sequence

MAEDTYSHKMVKTNHRRCRTKFTEEQLKILINTFNQKPYPGYATKQKLALEINTEESRIQIWFQNRRARH      1 - 70
GFQKRPEAETLESSQSQGQDQPGVEFQSREARRCRTTYSASQLHTLIKAFMKNPYPGIDSREELAKEIGV     71 - 140
PESRVQIWFQNRRSRLLLQRKREPVASLEQEEQGKIPEGLQGAEDTQNGTNFTSDSHFSGARTW          141 - 204
//

Text Mined References (3)

PMID Year Title